.
The Open Protein Structure Annotation Network
PDB Keyword
.

282419

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 282419
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2086,TM0546, 382462 Molecular Weight 37759.59 Da.
    Residues 348 Isoelectric Point 6.48
    Sequence mklgilekyrrflpvtdktpmlslnegntpliplvnmsrelginiyvkyegsnptgsfkdrgmvvavak aleegskaimcastgntsasaaayaaragikaivlipegkialgklaqamiygavvlqvrgnfdkclel vkeitskypitlvnsinpyrlegqktaafeivdelgdapdyhfipvgnagnisaywmgykeyyqhgfst klpkmmgfqaegaapivrghpienpetvatairignpanwekavrardesggdidmvsdeeilraqrll aqkegifcepasaasiagllkkhrqgifrggeivvctltgnglkdpnivisqleppriiegrveeilevldi
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0546

    Name: threonine synthase
    Metabolic Subsystem: Threonine Metabolism
    Reaction: : h2o + phom --> pi + thr-L
    Classification: EC:4.2.3.1
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0546
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch