.
The Open Protein Structure Annotation Network
PDB Keyword
.

282413

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 282413
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2084,TM0540, _0114.000251_, PF05681, 84909 Molecular Weight 30552.81 Da.
    Residues 272 Isoelectric Point 6.18
    Sequence minkhvisekikkaiveanikinpeveeiieryegpfsdiikenyrvskeeklplcqdtgiveffvfig hevkleepieetlnravgevyseypfrysvvsdplferintgtntpaivhifqvkgksleirflvkggg senltvlrmmtptsdvekvkefviehikehgakacpplhvgigiggtadkalllsklaltksfkernkd pkyaglekelekelnflgigfqglgkgitvysvhiehfpthiatlpvavsvdcylcrrgkvtfed
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0540

    Name: fumarase
    Other genes that carryout this rxn: TM0541
    Metabolic Subsystem: Citric Acid Cycle
    Reaction: : fum + h2o <==> mal-L
    Classification: EC:4.2.1.2
     

    Ligand Information
    Ligands
    Metals

    Protein Summary

     

    Ligand Summary

     

     
     

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     TM0540.pdb
    No description
    77.84 kB00:17, 27 Jun 2009AdminActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch