The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 282372
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2071,TM0499 Molecular Weight 19286.49 Da.
    Residues 162 Isoelectric Point 5.66
    Sequence mrrywlvilliaivilffrvkwevkriyvedpevkkmveeilrekryrykftdtrersliiekdraivp pnevvlhldwpekvkkrvkelvepffqkiglsatesqmataevfleaviesffegnqslfensyycgei yvfsngkcvaeydpstgelvfldk
      BLAST   FFAS

    Ligand Information
    Transmembrane protein


    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch