.
The Open Protein Structure Annotation Network
PDB Keyword
.

282317

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 282317
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2063,TM0444 Molecular Weight 51125.70 Da.
    Residues 458 Isoelectric Point 8.31
    Sequence mrkerdylgkleiegevyygihtkralmnfpstgekldetfiwayfmvkkacallntelgyldertgna ivkacdewedlkkhvvvdplsggagtsinmnvnevianrateilggkkgeylvdpidhvnlhqstndtf ptsakiativklrrlidevinlqekiqekekefysirkpgrtqlmdgppimlgqefgafadalardrwr lykveerirsvniggtaigtgvgapkdyilkivekvrevtkvkiakaenlidatqnwdvfaevhgllks lavnlykisndirllgsgpntvigelilpavqagssimpgkinpvvseyvmqichmvfghdmilnhaca lgnlelnqfaplivhltlksltlltnacrslasyiskikannerceehlrrsvsnltpliklfgyeavs eaikkanwdikkaveilsqeknipveeilkvlnlkkmtglgysl
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0444

    Name: L-aspartase
    Metabolic Subsystem: Alanine and Aspartate Metabolism
    Reaction: : asp-L <==> fum + nh4
    Classification: EC:4.3.1.1
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0444
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch