.
The Open Protein Structure Annotation Network
PDB Keyword
.

282316

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 282316
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2062,TM0443, 84989 Molecular Weight 54150.27 Da.
    Residues 476 Isoelectric Point 5.56
    Sequence miaaidigtesarlmfksngewkvlkksyriffpspeaaeqdpneifsavfdllkqvpnedevlyvgms svfhsiigldenlnpvtpllnwadrrsfrekeelekkygvrffyektacplhpmywpskilwmkknsna kkfcsikayivnkmtrefveelslasgtgmmnihslewdgeileitgvrkedlpeikspytqlrvkdei akelgfkkvylvlgggdgvmtnvgvnvmdpdsatvtigtsgafrvvmdrpvidregistwcylideeny vlggainnggivlmwlrdimkfkdyndiieeakespaganglvflpflngeraphwreryrgvlvglts shrrsdiaraalegicfrikdihnavkrvgsvdpnrivatggftsspywvqllsdvlgkdiivtnvenp safgayvmalkslgedvegfiekevrvervfhpdsernavyerlyndykflyeklvdyyyke
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0443

    Name: gluconokinase
    Metabolic Subsystem: Entner-Doudoroff pathway
    Reaction: : atp + glcn --> 6pgc + adp + h
    Classification: EC:2.7.1.12
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0443
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch