.
The Open Protein Structure Annotation Network
PDB Keyword
.

282301

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 282301
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2057,TM0428, 84964 Molecular Weight 49375.26 Da.
    Residues 435 Isoelectric Point 8.27
    Sequence mkkrfkyrtleemrweaitlgidlplsgdfdvfrdlvdlgsktipnrfvdqpmegndaqldgtpgpltl rryrklaeggagviwveaiavsreargndrqlmlteetvnsfrsfvaeiksvslktknfepyivaqlth pgrfgknrkilfhdkfldekygitedfplmsdeeldslkeqylraakfaktagfdavdikachryllse llaahtregkyggsyenrtkllkdivrlvrkeveiditvrlnlsdfipypygwgsteegtldftepgrl lkeleelgvkiinvtastpylkphinrpydemgkynppehpivgamrllnlaklaketlsktlvvasgf twfrqfapyvaagmlkngwcdfvgfgrmtfaypdypkdiltkgeldpkkvcitcnkcaelkaagescgc vvrdgevylpiyrkmeeskks
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0428

    Name: succinate dehydrogenase
    Other genes that carryout this rxn: TM0427
    Metabolic Subsystem: Citric Acid Cycle
    Reaction: : fad + succ <==> fadh2 + fum
    Classification: EC:1.3.99.1
     
    Name: succinate dehydrogenase cytochrome b
    Other genes that carryout this rxn:TM0427
    Metabolic Subsystem: Energy Metabolism
    Reaction: : fadh2 + q <==> fad + qh2

     
    Name: NADPH:flavin oxidoreductase
    Metabolic Subsystem: Energy Metabolism
    Reaction: fad[c] + h[c] + nadph[c] <==> fadh2[c] + h[e] + nadp[c]

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0428
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch