.
The Open Protein Structure Annotation Network
PDB Keyword
.

282300

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 282300
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2056,TM0427, 530690 Molecular Weight 75463.83 Da.
    Residues 664 Isoelectric Point 6.18
    Sequence mresvvklneytlrifslntivvgsgaaglnavdrvfsfgqkdvalltdnlkwgtsrntgsdkqtyykl tlagnvpdsvyelaetlfnggsmdgdialveaalsaraffrlvelgvpfphsrygeyvgyktdhdpkqr atsagpltsyymceklleeirrkgikifegyqvigiltdrneektiglialdlnniddpekryvlfnvk niiyatggpagmfyfhsvyppvhfgatgiafeagvmgknltewqfgiaskkfrwnlsgtyqqvipryvs tdengnderefleeyfpdpstmlnaiflkgyqwpfdvrkiknygsslidilvfyetvikgrrvwldftr npswgskngeldfsllgkeayeylknsgalfgrpidrlekmnrpaievylqhgidlrkeyleigvcaqh nngglhgniwwesnlkhffpvgevngshgvyrpggsalnsgqvggvraaqyivenysgdplceeeilee akdqilkkielgesfvkkitgksnvssilkeisersmrsmgivrsleeagkgknealrdfnnliekvel ssirqlpfafrlydvlltqyvylsavenyiesggksrgsyivhdptgelpvpnlpemfryslagesfnk kiqrvrckenrceffwdpvkeipredtwfetiwnsfmrrevfr
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0427

    Name: succinate dehydrogenase
    Other genes that carryout this rxn:TM0428
    Metabolic Subsystem: Citric Acid Cycle
    Reaction: : fad + succ <==> fadh2 + fum
    Classification: EC:1.3.99.1
     
    Name: succinate dehydrogenase cytochrome b
    Other genes that carryout this rxn: TM0428
    Metabolic Subsystem: Energy Metabolism
    Reaction: : fadh2 + q <==> fad + qh2

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0427
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch