.
The Open Protein Structure Annotation Network
PDB Keyword
.

282275

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction
    Target Id 282275
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2051,TM0402 Molecular Weight 46424.86 Da.
    Residues 435 Isoelectric Point 6.59
    Sequence mrkrvfslllvlaflsvgfaqdgvtdvgwsldmvwilisaalvffmqagfamvesgftrakntvnvlmk nlmdfaigsvvffifgywimfgkhpltfdpstkeglwdfamwmfqmafagtaativsgamaertkfpay laytgfitgiiysvvgrwiwgggwlaqkgfidfagstvvhsvggwaamigasllgprfgkydsqgnpkp ipghniplaalgtfilwfgwfgfnggstlagtngaigmiilntnlaaatgalaamvtvwakygkpdasm tmngalaglvaitapcavvspvssliigaiggvivvfaveffdkvlkiddpvgaisvhgvngawgtlav glfaeskyalasgmgdvnglffgggvhqlgvqflgvvsvfawtvvtsflvfwfikktiglrvdrdielk gldieehgmegyadfeifttr
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0402

    Name: ammonia reversible transport
    Metabolic Subsystem: Transport
    Reaction: nh4[e] <==> nh4[c]

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0402
    generated 12/2008
    Transmembrane protein

    HMM_TM0402

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch