.
The Open Protein Structure Annotation Network
PDB Keyword
.

282231

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 282231
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2043,TM0356, 89336, 90116 Molecular Weight 43107.89 Da.
    Residues 401 Isoelectric Point 6.08
    Sequence mitledikeaqrtlknvvhrtalayssvlsevtggeiylkmenlqktgsfkirgaynkiahlseeerkr gvvaasagnhaqgvalaaqifgipativmpryaplskitktrnlgaqvilegnifdeayeaalriqekt gavfvhpfndphviagqgtigleimedlpdvevvvvpvgggglisgvsvaiksmnpevkvigvqtenmp smiaslrrgraervegkptladgiavkkpgdltfelvkkyvdemvavneeeiadailflleqakvvaeg agavgvaavlnkldvkgkkvaivisggnidvnmidriinkglvksgrkvfietfvmdrpgalkellgiv aelganvlsvfhnrsakevpigfakieleletvdekhveeiervliakgyevrivg
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0356

    Name: L-serine ammonia-lyase
    Metabolic Subsystem: Glycine and Serine Metabolism
    Reaction: : ser-L <==> h + nh3 + pyr
    Classification: EC:4.3.1.19
     
    Name: L-threonine deaminase
    Metabolic Subsystem: Threonine Metabolism
    Reaction: : thr-L --> 2obut + nh4
    Classification: EC:4.3.1.19
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0356
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch