The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 282200
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2038,TM0325, 282279 Molecular Weight 26633.38 Da.
    Residues 251 Isoelectric Point 5.81
    Sequence mnfqgkvvlitgagsgigkkaavmfaergakvaindiseekgketveliksmggeaafifgdvakdaeq ivkktvetfgrldilvnnagivpygnieetseedfdktmavnvkgpfllskyaveqmkkqgggvivnvs seagligiprrcvysvskaallgltrslavdyvdygirvnavcpgttqseglmarvkaspnpeellkkm tsripmkrlgkeeeiafailfaacdeagfmtgsiinidggstav
      BLAST   FFAS

    Ligand Information
    Model TM0325
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch