The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Site JCSG
    Status Purified
    Target Id 282172
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2027,TM0296, 3.40.1190.20, 84867 Molecular Weight 34993.25 Da.
    Residues 315 Isoelectric Point 4.96
    Sequence mnvlctgeilidfisedkgknlsqselfrkkaggsplnvavalkrlgrevsflgklggdqfsefllevm kkegidtthiifdssckttlafvardaqgnpdfvffrekpadtnlrpeevnidpaqfsflhigsyslav epsrsaylkvmetfleegkpvsydpnvrpsliedrntfvkdfleisskvdivklsdkdleyifqedlet avdkipikengllfvtmgergclvkfkgekrmvpsfkvkpvdatgcgdsftaavihkylektpetieda veigkfanavaaivitrvggvdampvldevemflsnqer
      BLAST   FFAS


    Reactions found in Metabolic Reconstruction for TM0296

    Name: hexokinase (D-fructose:ATP)
    Metabolic Subsystem: Carbohydrate Metabolism
    Reaction: : atp + fru --> adp + f6p + h
    Classification: EC:

    Ligand Information
    Model TM0296
    generated 12/2008

    Protein Summary

    Ligand Summary





    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch