.
The Open Protein Structure Annotation Network
PDB Keyword
.

282165

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Site JCSG
    Status Purified
    Target Id 282165
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2024,TM0289, 29348765, 89364 Molecular Weight 46462.39 Da.
    Residues 419 Isoelectric Point 6.55
    Sequence maerlgilvgggpapginsvissvtieainnglevigiydgfkhlvegktnmvkklsiedvsrihiegg silrtsrvnpakseetlektvqtlkklgikylvtiggddtafsaskvcerskgeikvvhvpktidndlp lpenmptfgfetarhvatelvynlmqdsrttnrwyfvammgreaghlalgvgkaasatitiipeefkeg vtleevcdvldgailkrklmgrddgvavigegiaekmdpeelanipgvivekdphghlrlaeiplatil kraierryaergerihivdvtigyelrsarpipfdivytrtlgygavrfllgdysdlpggmvcvvggri kilpfdafmdpktgrtkvrvvdvrsedyrvarkymirlekkdledpetleklaklakmepeefkkkywhttelp
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0289

    Name: phosphofructokinase (ppi-dependent
    Metabolic Subsystem: Glycolysis/Gluconeogenesis
    Reaction: : f6p + ppi --> fdp + h + pi
    Classification: EC:2.7.1.11
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0289
    generated 12/2008

    Protein Summary




    Ligand Summary

    pyrophosphate-dependent 6-phosphofructokinase,  phosphofructokinase fold (c.89), 3 paralogs in TM, catalyses reaction f6p + ppi --> fdp + h + pi

    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch