The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Site JCSG
    Status Purified
    Target Id 282122
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2008,TM0243 Molecular Weight 32701.96 Da.
    Residues 283 Isoelectric Point 8.94
    Sequence mmlrasygtirkvngnsslemdtaylmlgercvynclycaqsrsstspshflsrvtwkevsedllgkln drfkrvciqvvsypsygkdlrliiprfripvsvsvravsieevveyfelgadrvgiavdvpnktlfeki rggkyerhlhilekvsemfpgritthvivglgesdkdivdftvwarernivvslfaftpikgtafenre rpsleryrkiqlvtylleknlikpeniifdsngkiidvewngefpeealrtrgcphctrpyynesprgp iynvhwr
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary





    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch