.
The Open Protein Structure Annotation Network
PDB Keyword
.

282116

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 282116
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2005,TM0237, 3.40.1190.10 Molecular Weight 54737.53 Da.
    Residues 490 Isoelectric Point 5.82
    Sequence mnistivsnlkdlilevrapydleitgvsnhsskvkkgdlficrrgekfdsheiipevmekgavavvve reidldfpyiqvfdsryfeakvaslffedpwkdvltfgvtgtngkttttmmiyhmltslgergsvltta vkrilgnsyyddittpdaitilsamkenregggkffalevsshalvqqrvegvrfdvgiftnisrdhld fhgtfenylkaklhlfdllkddgvavlnesladafnrksrkitfgtsknadyrlgnievswegtqfvle tpdgllkvftraigdfnaynaaaaiaalhqlgydpkdlassletftgvegrfevvrgakkiglnvvvdf ahspdalekllknvrkisqgrvivvfgaggnsdrgkrpmmsevaskladvvilttddprgedpeqimed likgidkrkpylvlfdrreaietaltianrgdsvviagrgheryqiideekkvpfqdrevveeiirdkl kgrkyaq
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0237

    Name: UDP-N-acetylmuramoyl-L-alanyl-D-glutamyl-L-lysine synthetase (gamma-glutamate)
    Metabolic Subsystem: Peptidoglycan Biosynthesis
    Reaction: : atp + lys-L + uamag --> adp + h + pi + uGgl
    Classification: EC:6.3.2.7
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0237
    generated 12/2008

    Protein Summary


    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch