.
The Open Protein Structure Annotation Network
PDB Keyword
.

282104

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Site JCSG
    Status Purified
    Target Id 282104
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2001,TM0224, 282154 Molecular Weight 26272.49 Da.
    Residues 231 Isoelectric Point 9.84
    Sequence migekiisfesidstnrflkenyrfypdgtvvvaleqtsgygrsgrhwhspkgglwfsvlfkprkplel sfytrvfsvavvktlenmkihanikwpndvyingrklagvlsegifegakplavvvgvgmnvnneipae lktraislkeimgkeisivklmesmlknarvifrkysrkkealtriwkryllqkegdlislegkkgkiv kinpdsllidfdgeikkvyslsph
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0224

    Name: biotin-[acetyl-CoA-carboxylase] ligase
    Metabolic Subsystem: Biotin Biosynthesis
    Reaction: : atp + btn + h --> btamp + ppi
    Classification: EC:6.3.4.15
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0224
    generated 12/2008

    Protein Summary


    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch