.
The Open Protein Structure Annotation Network
PDB Keyword
.

282050

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Site JCSG
    Status Purified
    Target Id 282050
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1981,TM0170, 83910 Molecular Weight 8597.49 Da.
    Residues 73 Isoelectric Point 4.47
    Sequence meydvyvrvskedvhllnylleveehmfnirkyedgvlkiitpfpeeaikllegckemvdleilevken pgea
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch