.
The Open Protein Structure Annotation Network
PDB Keyword
.

282032

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Site JCSG
    Status Purified
    Target Id 282032
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1976,TM0152, RER070207002448, BIG_379, 282817, 89880, 83950, 282813 Molecular Weight 24471.81 Da.
    Residues 215 Isoelectric Point 8.28
    Sequence mslreelwlwkkeklaehvannlrkkkhevwiardreeilervkelipegatvsaggsltladtgviel lrsgrynfldraaaktreeveeiyrksfwadyyftsvnaitedgklvfldgngnrvaavvfgpknvvvi asvnkvvkdveearerlryispmnskrlnletpctktgfcadcsspqricdyflvvesgvrqpgrfkvi ltledfgl
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch