.
The Open Protein Structure Annotation Network
PDB Keyword
.

281957

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Site JCSG
    Status Purified
    Target Id 281957
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1960,TM0076 Molecular Weight 86844.24 Da.
    Residues 778 Isoelectric Point 5.55
    Sequence melyrdpsqpievrvrdllsrmtleekvaqlgsvwgyelidergkfsrekakellkngigqitrpggst nlepqeaaelvneiqrflveetrlgipamiheecltgymglggtnfpqaiamastwdpdliekmttavr edmrkigahqglapvldvardprwgrteetfgespylvarmgvsyvkglqgedikkgvvatvkhfagys aseggknwaptniperefkevflfpfeaavkeanvlsvmnsyseidgvpcaanrklltdilrkdwgfeg ivvsdyfavkvledyhriardkseaarlaleagidvelpktecyqylkdlvekgiisealideavtrvl rlkfmlglfenpyvevekakieshrdialeiarksiillkndgilplqknkkvaligpnagevrnllgd ymylahiralldniddvfgnpqiprenyerlkksieehmksipsvldafkeegiefeyakgcevtgedr sgfeeaieiakksdvaivvvgdksgltldcttgesrdmanlklpgvqeelvlevaktgkpvvlvlitgr pyslknvvdkvnailqvwlpgeaggraivdiiygkvnpsgklpisfprsagqipvfhyvkpsggrshwh gdyvdestkplfpfghglsytkfeysnlriepkevppagevvikvdvenigdrdgdevvqlyigrefas vtrpvkelkgfkrvslkakekktvvfrlhmdvlayynrdmklvvepgefkvmvgsssedirltgsfsvv gekrevvgmrkffteacee
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0076

    Name: beta-glucosidase
    Other genes that carryout this rxn:TM0025
    Metabolic Subsystem: Carbohydrate Metabolism
    Reaction: : cellb + h2o --> glc-D
    Classification: EC:3.2.1.21
     
    Name: "glucan hydrolysis by beta-1,4- and beta-1,3 glucosidase"
    Other genes that carryout this rxn:TM0024 TM1524 TM0025
    Metabolic Subsystem: Glucan Metabolism
    Reaction: : glucan6 + h2o --> glc-D

     
    Name: "glucan hydrolysis by beta-1,4- and beta-1,3 glucosidase"
    Other genes that carryout this rxn:TM1524 TM0025 TM0024
    Metabolic Subsystem: Glucan Metabolism
    Reaction: : glucan4 + h2o --> glc-D

     
    Name: laminaribiase
    Other genes that carryout this rxn:TM0025
    Metabolic Subsystem: Laminarine Metabolism
    Reaction: : h2o + lmn2 --> glc-D

     
    Name: exo-xylosidase
    Other genes that carryout this rxn:TM0025
    Metabolic Subsystem: Xylan Metabolism
    Reaction: : h2o + xylb <==> xyl-D

     
    Name: exo-xylosidase
    Other genes that carryout this rxn:TM0025
    Metabolic Subsystem: Xylan Metabolism
    Reaction: : h2o + xyl3 <==> xyl-D

     
    Name: exo-xylosidase
    Other genes that carryout this rxn:TM0025
    Metabolic Subsystem: Xylan Metabolism
    Reaction: : h2o + xyl4 <==> xyl-D

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0076
    generated 12/2008

    Protein Summary


    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch