.
The Open Protein Structure Annotation Network
PDB Keyword
.

281955

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Site JCSG
    Status Purified
    Target Id 281955
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1959,TM0074 Molecular Weight 37206.99 Da.
    Residues 332 Isoelectric Point 7.66
    Sequence mevlrtenlksyyildifgkkrvvkavddvnisimeneiygiagesgcgkstllralfaaieppqrivg gkvlyrengkevdvyslsdeerrrlrwsfisyvpqgsmsvlnpvvkiketfkdfieshttgktkeeaye makehikelglpieilnayphqlsggmrqrvtialatvlspkviiadepttaldvvtqrgvvqllkeiq ssrqntiilvthdmgvhanvtdriaimyagkiieegkteeifenpmhpytkyliyslpkfgdkgrresa pgsppsladlppgcsfhprcphafdrckkevpplkeylpghrvacwlveegknaas
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0074

    Name: Xylotriose ABC transport
    Other genes that carryout this rxn:TM0075 TM0071 TM0072 TM0073
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + xyl3[e] --> adp[c] + h[c] + pi[c] + xyl3[c]

     
    Name: Xylobiose ABC transport
    Other genes that carryout this rxn:TM0075 TM0071 TM0072 TM0073
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + xylb[e] --> adp[c] + h[c] + pi[c] + xylb[c]

     
    Name: oligo-xylan ABC transport
    Other genes that carryout this rxn:TM0075 TM0071 TM0072 TM0073 TM0060 T
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + xylan4[e] --> adp[c] + h[c] + pi[c] + xylan4[c]

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0074
    generated 12/2008

    Protein Summary


    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch