The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Site JCSG
    Status Purified
    Target Id 281921
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1951,TM0040, 83898 Molecular Weight 31636.97 Da.
    Residues 278 Isoelectric Point 5.27
    Sequence mvyttpwnrkiefgrtmvmgiinvtpdsffadsrkqsvleavetakkmieegadiidvggmstrpgsdp vdeeeelnrvipvirairsitdvpisvdtyrwrvalkaleagadivndisgyqfepdivrvvsennvpy vlmhikgtpktmqenphyedvvkeikeyftekieylkekgvnqivldpgigfgkryednleilrridef kelklpiligasrksfigitlgnvppeerlegtlavtayctmkgvdiirvhdvlpnkrvirmmeailwqrl
      BLAST   FFAS


    Reactions found in Metabolic Reconstruction for TM0040

    Name: dihydropteroate synthase
    Metabolic Subsystem: Folate Metabolism
    Reaction: : 2ahhmd + 4abz --> dhpt + ppi
    Classification: EC:

    Ligand Information
    Model TM0040
    generated 12/2008

    Protein Summary

    Ligand Summary





    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch