TOPSAN > Proteins > JCSG > 281909

281909

Page last modified 19:50, 27 Oct 2010 by Admin

Email link

Summary Discussions

Molecular Characteristics
Site	JCSG
Status	Crystallized
Target Id	281909
Source	Thermotoga maritima msb8
Alias Ids	TPS1947,TM0028	Molecular Weight	37302.96 Da.
Residues	330	Isoelectric Point	8.17
Sequence	mkeillkaenvrayyklekvsvkavdglsfeiledevigvvgesgcgkttlsnvifmnmvkpltlvdgk iflrvngefvelssmtrdevkrkfwgkeitiipqaamnalmptirmekyvrhlaeshgideeelldkar rrfeevgldplwikrypfelsggmrqraviaiatilnpslliadeptsaldvvnqkvllkvlmqmkrqg ivksiifithdiatvrqiadrmiimyagkivefapvesllekplhpytqglfnsvltpepevkkrgitt ipgappnlinppsgcrfhprcphamdvckekepplteiepgrrvacwlymeera
	BLAST FFAS

Pathway
Reactions found in Metabolic Reconstruction for TM0028
Name: Cellobiose transport via ATP transporter Other genes that carryout this rxn: TM0030 TM0029 TM0027 TM0031 TM1221 T Metabolic Subsystem: Transport Reaction: atp[c] Name:ATP Formula:C10H12N5O13P3 KEGG: C00002 + cellb[e] Name:cellobiose Formula:C12H22O11 KEGG: C00185 + h2o[c] Name:H2O Formula:H2O KEGG: C00001 --> adp[c] Name:ADP Formula:C10H12N5O10P2 KEGG: C00008 + cellb[c] Name:cellobiose Formula:C12H22O11 KEGG: C00185 + h[c] Name:H+ Formula:H KEGG: C00080 + pi[c] Name:Phosphate Formula:HO4P KEGG: C00009
Name: Laminoribiose transport via ABC-transporter Other genes that carryout this rxn: TM0030 TM0029 TM0027 TM0031 TM1204 T Metabolic Subsystem: Transport Reaction: atp[c] Name:ATP Formula:C10H12N5O13P3 KEGG: C00002 + h2o[c] Name:H2O Formula:H2O KEGG: C00001 + lmn2[e] Name:Laminaribiose Formula:C12H22O11 KEGG: --> adp[c] Name:ADP Formula:C10H12N5O10P2 KEGG: C00008 + h[c] Name:H+ Formula:H KEGG: C00080 + lmn2[c] Name:Laminaribiose Formula:C12H22O11 KEGG: + pi[c] Name:Phosphate Formula:HO4P KEGG: C00009

Ligand Information
Ligands
Metals

Modeled

Model TM0028
generated 12/2008

Reviews References Images Files Tags

Reviews

No references found.

Add tag

Tag page

What links here

Attach file or image

Images 0
No images to display in the gallery.

You must login to post a comment.

All content on this site is licensed under a Creative Commons Attribution 3.0 License