.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vr3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of acireductone dioxygenase (ARD) from Mus musculus at 2.06 angstrom resolution. Proteins 64 808-813 2006
    Site JCSG
    PDB Id 1vr3 Target Id 354741
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS1340,13543033 Molecular Weight 21522.48 Da.
    Residues 179 Isoelectric Point 5.31
    Sequence mvqawymdestadprkphraqpdrpvsleqlrtlgvlywkldadkyendpelekirkmrnyswmdiiti ckdtlpnyeekikmffeehlhldeeiryilegsgyfdvrdkedkwirismekgdmitlpagiyhrftld eknyvkamrlfvgepvwtpynrpadhfdarvqymsflegta
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.06 Rfree 0.19532
    Matthews' coefficent 3.71 Rfactor 0.16229
    Waters 169 Solvent Content 66.57

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Mouse enzyme aci-reductone dioxygenase (ARD; GI: 13543033, EC 1.13.11.-, Pfam03079), belongs to the superfamily of metal-containing RmlC-like cupins (PubMed:16783794). ARD represents a branch point in the methionine salvage pathway leading from 5-methylthioadenosine (MTA) to methionine and catalyzes different reactions, depending on the type of metal ion bound in the active site (PubMed:11371200, 9880484).

    Proteins from this family, such as immediate-early ethylene response gene OsARD1 (PubMed:16297065) were proposed to be part of early feedback activation of the methionine cycle by low levels of ethylene  to ensures the high and continuous rates of ethylene synthesis required for long-term ethylene-mediated submergence adaptation without depleting the tissue of AdoMet. OsARD was also found to be novel water-deficit-suppressed gene (PMID: 16169685). Another member of ARD family - membrane-type 1 matrix metalloproteinase cytoplasmic tail binding protein-1 (MTCBP-1) acts as an eukaryotic aci-reductone dioxygenase (ARD) in the methionine salvage pathway (PMID: 15938715) and is possible multifunctional protein acting as an invasion suppressor down-regulated in tumors (PubMed:14718544). Protein Sip-L (from ARD protein family) was identified as cellular factors that was capable of supporting hepatitis C virus replication in 293EBNA cells (PMID: 11602742). The mRNA of another protein (GenBank:AAC08430, gi2996183) from ARD protein family is abundant in the third stage larvae of the parasitic nematode, Ostertagia ostertagi (PubMed:10769181).

    ARD structure is typified by two antiparallel beta-sheets that form a cup-shaped, beta-sandwich jelly roll and has structure similar to RmlC-like cupins superfamily.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch