.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vr0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of 2-phosphosulfolactate phosphatase (ComB) from Clostridium acetobutylicum at 2.6 A resolution reveals a new fold with a novel active site. Proteins 65 771-776 2006
    Site JCSG
    PDB Id 1vr0 Target Id 357129
    Molecular Characteristics
    Source Clostridium acetobutylicum atcc 824
    Alias Ids TPS1374,15026306, 289434 Molecular Weight 26143.01 Da.
    Residues 235 Isoelectric Point 6.64
    Sequence mkidliisaddikeekvknktavvidmlratsvittalnngckrvvpvltveealkkvkeygkdailgg erkglkiegfdfsnspmeytedvvkgktlimtttngtraikgsetardiligsvlngeavaekivelnn dvvivnagtygefsiddficsgyiincvmdrmkkleltdaattaqyvyktnedikgfvkyakhykrime lglkkdfeycckkdivklvpqytngeil
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.49 Rfree 0.22938
    Matthews' coefficent 2.33 Rfactor 0.18994
    Waters 93 Solvent Content 46.90

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1vr0
    1. The Buccaneer software for automated model building. 1. Tracing protein chains
    K Cowtan - Acta Crystallographica Section D: Biological , 2006 - scripts.iucr.org
     
    2. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    3. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    4. Crystal structure of 2_phosphosulfolactate phosphatase (ComB) from Clostridium acetobutylicum at 2.6 resolution reveals a new fold with a novel active site
    M DiDonato, S Krishna - Proteins: Structure, , 2006 - Wiley Online Library
     

    Protein Summary

    The 15026306 from C. acetobutylicum encodes 2-phosphosulpholactate phosphatase (ComB; EC 3.1.3.71). Analysis of the crystallographic packing of 15026306 using the PQS server {Henrick, 1998} indicates that a dimer is the biologically relevant form.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch