.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vqy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of hypothetical protein (np_396154.1) from Agrobacterium tumefaciens at 2.40 A resolution. To be published
    Site JCSG
    PDB Id 1vqy Target Id 356436
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS1361,NP_396154.1 Molecular Weight 12028.31 Da.
    Residues 104 Isoelectric Point 6.58
    Sequence miveeriyrirggkmqeylklvreegiaiqapilgnligyfvtdigplsqvihmwgyaslddraerrgk laedqrwqafiprlsvliessenrillptdfsplr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.24436
    Matthews' coefficent 2.40 Rfactor 0.18633
    Waters 480 Solvent Content 48.44

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1vqy
    1. The Buccaneer software for automated model building. 1. Tracing protein chains
    K Cowtan - Acta Crystallographica Section D: Biological , 2006 - scripts.iucr.org
     
    2. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    3. A discrete view on fold space
    MJ Sippl, SJ Suhrer, M Gruber, M Wiederstein - Bioinformatics, 2008 - Oxford Univ Press
     
    4. Protein structural classification and family identification by multifractal analysis and wavelet spectrum
    SM Zhu, ZG Yu, A Vo - Chinese Physics B, 2011 - iopscience.iop.org
     
    5. A protein in search of function: NIPSNAP1 in mitochondrial branched-chain amino acid metabolon, brain and apoptosis
    M Nautiyal - 2009 - wakespace.lib.wfu.edu
     

    Protein Summary

    The Atu5224 (NP_396154.1) gene from Agrobacterium tumefaciens encodes a hypothetical protein from the NIPSNAP family PF07978.  The protein belongs to the class of alpha and beta proteins and reveals ferredoxin-like fold type SCOP54861.  The protein is homologous (51% sequence identity) to protein Atu4242 from Agrobacterium tumefaciens 2AP6 1VQS.  The NIPSNAP family proteins have putative roles in vesicular transport [Ref].

     

    Human NIPSNAP proteins act as IAP (inhibitor of apoptosis) antagonists [Ref]. They have also been implicated in Wnt signaling [Ref], another pathway involved in inhibiting apoptosis.

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    2. (No Results)

       


      Discuss this publication
    3. (No Results)

       


      Discuss this publication

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch