.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vqt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of Orotidine 5'-phosphate decarboxylase (TM0332) from Thermotoga maritima at 2.00 A resolution. To be published
    Site JCSG
    PDB Id 1vqt Target Id 282207
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1200,TM0332 Molecular Weight 22807.49 Da.
    Residues 201 Isoelectric Point 6.97
    Sequence mtpvlsldmedpirfidengsfevvkvghnlaihgkkifdelakrnlkiildlkfcdipstversiksw dhpaiigftvhscagyesveralsatdkhvfvvvkltsmegsledymdrieklnklgcdfvlpgpwaka lrekikgkilvpgirmevkaddqkdvvtleemkgianfavlgreiylsenprekikrikemrl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.22088
    Matthews' coefficent 2.58 Rfactor 0.18139
    Waters 62 Solvent Content 52.04

    Pathway

    Reactions found in Metabolic Reconstruction for TM0332

    Name: orotidine-5'-phosphate decarboxylase
    Metabolic Subsystem: Pyrimidine Biosynthesis
    Reaction: : h + orot5p --> co2 + ump
    Classification: EC:4.1.1.23
     

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The TM0332 gene of Thermotoga maritima encodes an orotidine 5'-phosphate decarboxylase (OPDase) (PF00215, COG0284, EC 4.1.1.23). The structure adopts a TIM barrel alpha/beta fold and is very similar to other bacterial OPDases including orthologs from Escherichia coli (PDB id: 1l2u, backbone rmsd 1.7 Å over 180 residues, 28% sequence identity), Bacillus subtilis (PDB id: 1dbt, backbone rmsd 1.9 Å over 185 residues, 26% sequence identity) and Geobacillus kaustophilus (PDB id: 2yyu, backbone rmsd 1.8 Å over 182 residues, 26% sequence identity). Further discussion of the structure, active site, catalytic mechanism and conformational changes induced by substrate binding can be found at Harris 2002.

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch