| Title | Crystal structure of N5-glutamine methyltransferase, HemK(EC 2.1.1.-) (TM0488) from Thermotoga maritima at 2.80 A resolution. To be published | | Site | JCSG | | PDB Id | | Target Id | 282361 | | Molecular Characteristics | | Source | Thermotoga maritima msb8 | | Alias Ids | TPS1209,TM0488 | Molecular Weight | 31607.68 Da. | | Residues | 282 | Isoelectric Point | 5.43 | | Sequence | mdtrknvsgaerkiwslirdcsgklegvtetsvlevllivsrvlgirkedlflkdlgvspteekrilel vekrasgyplhyilgekefmglsflveegvfvprpeteelvelalelirkygiktvadigtgsgaigvs vakfsdaivfatdvsskaveiarknaerhgvsdrffvrkgeflepfkekfasiemilsnppyvkssahl pkdvlfeppealfggedgldfyreffgrydtsgkivlmeigedqveelkkivsdtvflkdsagkyrfll lnrrss | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.80 | Rfree | 0.27281 | | Matthews' coefficent | 2.85 | Rfactor | 0.20824 | | Waters | 7 | Solvent Content | 56.55 |
| Ligand Information | | Ligands | | | Metals | | | |
Protein Summary
The TM0488 gene from Thermotoga maritima encodes a N5-glutamine methyltransferase, HemK (EC 2.1.1.-)
(PF01575, COG2890). The TM0488 structure adopts an S-adenosyl-L-methionine dependent methyltransferase fold and shows strong structural similarity (main-chain rmsd 0.4 Å over 266 residues) with N5-glutamine methyltransferase HemK from Thermotoga maritima (PDB id: 2nv8, 1sg9). See Schubert 2003 for more details on the structure and mechanism.
Ligand Summary
References
