.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vpy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of hypothetical protein (ef0366) from Enterococcus faecalis v583 at 2.52 A resolution. To be published
    Site JCSG
    PDB Id 1vpy Target Id 357242
    Related PDB Ids 1ztv 
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS1919,EF0366, _0050.001329_, 289807, 289432 Molecular Weight 32134.14 Da.
    Residues 277 Isoelectric Point 5.81
    Sequence mirlgltsfsehdyltgkkrstlyeyashlplvemdtayygippkervaewvkavpenfrfvmkvysgi scqgewqtyyaseeemitaflesmaplieskklfaflvqfsgtfgctkenvaylqkirhwfkdlpiaie lrnnswyqpnfvkqmlqfmkenqfslvivdepqiptnpvpfypyvtnpnlvlfrfhgrnaagwlandae wrkkrtlyhyntqeiadlseavlkmsqeakevgvifnnnsggdaaenalqmqkvlnlsyddlnpkqldlf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.52 Rfree 0.25697
    Matthews' coefficent 3.44 Rfactor 0.22493
    Waters 37 Solvent Content 63.91

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1vpy
    1. The Buccaneer software for automated model building. 1. Tracing protein chains
    K Cowtan - Acta Crystallographica Section D: Biological , 2006 - scripts.iucr.org
     
    2. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    3. Protein structure prediction based on the sliced lattice model
    CC Wang, CB Yang, HY Ann - 2008 Conference on , 2005 - etd.lib.nsysu.edu.tw
     
    4. Prediction of Protein Backbone Based on the Sliced Lattice Model
    CC Wang, CB Yang, HY Ann, HY Chang - 2008 - csie.npu.edu.tw
     

    Protein Summary

    The gene EF0366 from Enterococcus faecalis encodes for the NP_814157 amino acid sequence, a protein of unknown function belonging to the DUF72 group (PF01904). 

    Dali provided weak hits (Z=12) with the glucosaminidase 2epo, the dehydratase 3ban, and the TM0416 protein 2zvr.

    Please see the entry 1vpq (Dali Zscr=28) for more details but notice that this structure was co-crystallized with an unknown ligand.

    ToDo: Find out more about this ligand.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (2)

    FileSizeDateAttached by 
    1ztv.jpg
    No description
    50.98 kB19:20, 30 Jun 2008dweekesActions
    1ztv.png
    No description
    32.98 kB19:20, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch