.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vpk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of DNA polymerase III, beta subunit (TM0262) from Thermotoga maritima at 2.00 A resolution. To be published
    Site JCSG
    PDB Id 1vpk Target Id 282139
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1195,TM0262, _0106.000668_, _0032.000316_, 84862 Molecular Weight 40945.89 Da.
    Residues 366 Isoelectric Point 4.66
    Sequence mkvtvttlelkdkitiaskalakksvkpilagflfevkdgnfyicatdletgvkatvnaaeisgearfv vpgdviqkmvkvlpdeitelslegdalvissgstvfrittmpadefpeitpaesgitfevdtslleemv ekvifaaakdefmrnlngvfwelhknllrlvasdgfrlalaeeqieneeeasfllslksmkevqnvldn tteptitvrydgrrvslstndvetvmrvvdaefpdykrvipetfktkvvvsrkelreslkrvmviaskg sesvkfeieenvmrlvskspdygevvdevevqkegedlviafnpkfiedvlkhieteeiemnfvdstsp cqinpldisgylyivmpirla
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.23207
    Matthews' coefficent 2.73 Rfactor 0.19632
    Waters 164 Solvent Content 54.63

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1vpk
    1. The JCSG MR pipeline: optimized alignments, multiple models and parallel searches
    R Schwarzenbacher, A Godzik - Section D: Biological , 2007 - scripts.iucr.org
     

    Protein Summary

    The TM0262 gene from Thermotoga maritima encodes the C-terminal domain of the beta subunit of DNA polymerase III (PFAM:PF02768, COG: COG0592, EC:2.7.7.7). The TM0262 structure adopts a DNA clamp fold and shows strong structural similarity (main-chain rmsd 1.8 Å over 346 residues with 27% sequence identity) with the beta subunit from DNA polymerase III from Escherichia coli (PDB ids: 3dlf, 1mmi) (Oakley 2003) and Streptococcus pneumoniae (PDB:2awa). For more details on the structure and function of TM0262 see Georgesku 2008.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch