.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vph

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of hypothetical protein (13815834) from Sulfolobus solfataricus at 1.76 A resolution. To be published
    Site JCSG
    PDB Id 1vph Target Id 358101
    Molecular Characteristics
    Source Sulfolobus solfataricus p2
    Alias Ids TPS1383,13815834, 289701, 289430 Molecular Weight 15573.94 Da.
    Residues 137 Isoelectric Point 5.35
    Sequence mkvyfddiyvstarqfelvditdqveqiveksgikngiclifvahstaaivaneherglmediltkike ftepsrswkhnliddnahahlgatflgaervfpvregklvrgtwqniflveldgprserhitveilge
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 1.76 Rfree 0.22173
    Matthews' coefficent 2.13 Rfactor 0.18914
    Waters 286 Solvent Content 41.76

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1vph
    1. Sensitive genome-wide screen for low secondary enzymatic activities: the YjbQ family shows thiamin phosphate synthase activity
    E Morett, G Saab-Rincn, L Olvera, M Olvera - Journal of molecular , 2008 - Elsevier
     
    2. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    3. Autoindexing with outlier rejection and identification of superimposed lattices
    NK Sauter, BK Poon - Journal of Applied Crystallography, 2010 - scripts.iucr.org
     

    Protein Summary

    The gene SSO2532 from Sulfolobus solfataricus encodes NP_343872 protein belonging to the UPF0047/DUF74 family (PF01894). A predicted functional partner (score 0.7) for SSO2532 is the pyrI gene that codes for an aspartate carbamoyltransferase regulatory chain.

    SCOP classifies 1vph inside the class of alpha and beta (a+b), dodecin subunit-like fold, YbjQ-like (super)family SCOP117782. This protein is highly conserved among bacterial species, and several structures of its homologues from other organisms have been solved: 1VMF (Dali Zscr=22), from Bacillus halodurans; and 2CU5 (Z=18), from Thermus Thermophilus.  

    Dodecins are most likely involved in prokaryotic flavin storage and homeostasis [Ref][Ref].  The dodecin monomers assemble to hollow sphere-like usually dodecameric complexes.  The degree of oligomerization of dodecins seems to vary, depending on sequence variations and presence of the flavin cofactor.

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    2. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch