.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vmd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Methylglyoxal synthase (TM1185) from Thermotoga maritima at 2.06 A resolution. To be published
    Site JCSG
    PDB Id 1vmd Target Id 283050
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1269,TM1185, 282368 Molecular Weight 19091.04 Da.
    Residues 166 Isoelectric Point 6.44
    Sequence msdrprrykifmdkkkrialiahdrrkrdllewvsfnlgtlskhelyatgttgallqeklglkvhrlks gplggdqqigamiaegkidvliffwdplepqahdvdvkaliriatvynipvaitrstadflissplmnd vyekiqidyeeelerrirkvvegeeeet
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.06 Rfree 0.21884
    Matthews' coefficent 2.43 Rfactor 0.16732
    Waters 142 Solvent Content 48.93

    Pathway

    Reactions found in Metabolic Reconstruction for TM1185

    Name: methylglyoxal synthase
    Metabolic Subsystem: Others
    Reaction: : dhap --> mthgxl + pi
    Classification: EC:4.2.3.3
     

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1vmd
    1. Autoindexing with outlier rejection and identification of superimposed lattices
    NK Sauter, BK Poon - Journal of Applied Crystallography, 2010 - scripts.iucr.org
     

    Protein Summary


    The gene TM1185 from Thermotoga maritima encodes an enzyme methylglyoxal synthase (MGS) COG1803.  The protein belongs to a MGS-like domain superfamily PF02142.  This domain composes the whole protein of MGS and the domain is also found in carbamoyl phosphate synthetase (CPS) where it forms a regulatory domain that binds to the allosteric effector ornithine. This family also includes inosicase.  MGS catalyzes the enolization of dihydroxyacetone phosphate (DHAP) to produce methylglyoxal. The first part of the catalytic mechanism is believed to be similar to TIM (triosephosphate isomerase) in that both enzymes utilize DHAP to form an ene-diolate phosphate intermediate. In MGS, the second catalytic step is characterized by the elimination of phosphate and collapse of the enediolate to form methylglyoxal instead of reprotonation to form the isomer glyceraldehyde 3-phosphate, as in TIM. This is the first reaction in the methylglyoxal bypass of the Embden-Myerhoff glycolytic pathway and is believed to provide physiological benefits under non-ideal growth conditions in bacteria.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch