The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase (TM0066) from Thermotoga maritima at 2.30 A resolution. To be published
    Site JCSG
    PDB Id 1vlw Target Id 281947
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1180,TM0066, 83928 Molecular Weight 22235.01 Da.
    Residues 205 Isoelectric Point 6.92
    Sequence mkmeelfkkhkivavlransveeakekalavfeggvhlieitftvpdadtvikelsflkekgaiigagt vtsveqcrkavesgaefivsphldeeisqfckekgvfympgvmtptelvkamklghtilklfpgevvgp qfvkamkgpfpnvkfvptggvnldnvcewfkagvlavgvgsalvkgtpdevrekakafvekirgcte
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.30 Rfree 0.22106
    Matthews' coefficent 2.16 Rfactor 0.17663
    Waters 120 Solvent Content 42.71


    Reactions found in Metabolic Reconstruction for TM0066

    Name: 2-dehydro-3-deoxy-phosphogluconate aldolase
    Other genes that carryout this rxn:TM0880 TM0128
    Metabolic Subsystem: Entner-Doudoroff pathway
    Reaction: : 4h2oglt <==> glx + pyr
    Classification: EC:
    Name: 2-dehydro-3-deoxy-phosphogluconate aldolase
    Metabolic Subsystem: Glucuronate Metabolism
    Reaction: : 2ddg6p <==> g3p + pyr
    Classification: EC:

    Ligand Information


    Google Scholar output for 1vlw
    1. Protein structure database search and evolutionary classification
    JM Yang, CH Tung - Nucleic acids research, 2006 - Oxford Univ Press
    2. Automated search-model discovery and preparation for structure solution by molecular replacement
    RM Keegan, MD Winn - Acta Crystallographica Section D: Biological , 2007 - iucr.org
    3. His-tag impact on structure
    M Carson, DH Johnson, H McDonald - Section D: Biological , 2007 - scripts.iucr.org
    4. Domain definition and target classification for CASP6
    M Tress, CH Tai, G Wang, I Ezkurdia - PROTEINS: , 2005 - Wiley Online Library
    5. The JCSG MR pipeline: optimized alignments, multiple models and parallel searches
    R Schwarzenbacher, A Godzik - Section D: Biological , 2007 - scripts.iucr.org
    6. I. Association behavior of ACHC-rich beta-peptide foldamers. II. Fluorine-19 NMR methods for monitoring alpha-peptide folding
    WC Pomerantz - 2008 - books.google.com

    Protein Summary

    TM0066 encodes a lysine-dependent (class-I aldolase) with a TIM-barrel fold. A detailed analysis of the structure and catalytic mechanism can be found at Fullerton 2006.

    Ligand Summary





    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch