.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vlm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of SAM-dependent methyltransferase, possible histamine N-methyltransferase (TM1293) from Thermotoga maritima at 2.20 A resolution. To be published
    Site JCSG
    PDB Id 1vlm Target Id 283157
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1277,TM1293, 84738, 89426 Molecular Weight 23917.62 Da.
    Residues 207 Isoelectric Point 8.40
    Sequence mwhiferfvneyerwflvhrfaylselqavkcllpegrgveigvgtgrfavplkikigvepsermaeia rkrgvfvlkgtaenlplkdesfdfalmvtticfvddperalkeayrilkkggylivgivdresflgrey eknkeksvfyknarffsteelmdlmrkagfeefkvvqtlfkhpselseiepvkegygegafvvirgtkk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.2461
    Matthews' coefficent 2.31 Rfactor 0.19162
    Waters 109 Solvent Content 46.36

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1vlm
    1. The Buccaneer software for automated model building. 1. Tracing protein chains
    K Cowtan - Acta Crystallographica Section D: Biological , 2006 - scripts.iucr.org
     
    2. In silico analysis of methyltransferase domains involved in biosynthesis of secondary metabolites
    M Ansari, J Sharma, R Gokhale - BMC , 2008 - biomedcentral.com
     

    Protein Summary

    TM1293 is a member of the SAM-dependent methyltransferase type 11 family, one of the largest and most divergent (41 SCOP families; 57 PFAM families).

    JCSG solved several proteins from PF08241, most recently 2p8j.

    See 2p8j entry for functional details.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch