| Title | Crystal structure of alanine dehydrogenase (AF1665) from Archaeoglobus fulgidus at 2.80 A resolution. To be published | | Site | JCSG | | PDB Id | | Target Id | 354281 | | Molecular Characteristics | | Source | Archaeoglobus fulgidus dsm 4304 | | Alias Ids | TPS1328,2648890 | Molecular Weight | 34827.03 Da. | | Residues | 322 | Isoelectric Point | 5.18 | | Sequence | metliltqeeveslismdeamnaveeafrlyalgkaqmppkvylefekgdlrampahlmgyaglkwvns hpgnpdkglptvmalmilnspetgfplavmdatyttslrtgaaggiaakylarknssvfgfigcgtqay fqlealrrvfdigevkaydvrekaakkfvsycedrgisasvqpaeeasrcdvlvtttpsrkpvvkaewv eegthinaigadgpgkqeldveilkkakivvddleqakhggeinvavskgvigvedvhatigeviaglk dgresdeeitifdstglaiqdvavakvvyenalsknvgskikffri | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.80 | Rfree | 0.2539 | | Matthews' coefficent | 2.38 | Rfactor | 0.21742 | | Waters | | Solvent Content | 48.22 |
| Ligand Information | | Ligands | | | Metals | | | |
| Google Scholar output for 1vll |
| 1. His-tag impact on structure |
| M Carson, DH Johnson, H McDonald - Section D: Biological , 2007 - scripts.iucr.org |
| |
| 2. Protein structure prediction based on the sliced lattice model |
| CC Wang, CB Yang, HY Ann - 2008 Conference on , 2005 - etd.lib.nsysu.edu.tw |
| |
| 3. Prediction of Protein Backbone Based on the Sliced Lattice Model |
| CC Wang, CB Yang, HY Ann, HY Chang - 2008 - csie.npu.edu.tw |
| |
| 4. The Buccaneer software for automated model building. 1. Tracing protein chains |
| K Cowtan - Acta Crystallographica Section D: Biological , 2006 - scripts.iucr.org |
| |
Protein Summary
The gene 2648890 from Archaeoglobus fulgidus encodes the enzyme alanine dehydrogenase EC:1.4.1.1 COG0686, a member of ornithine cyclodeaminase family PF02423. The enzyme belongs to the class of alpha and beta (a+b) proteins and reveals NAD(P)-binding Rossmann-fold domain fold type SCOP51734. The enzyme catalyzes the follwing reaction: L-alanine + H(2)O + NAD(+) <=> pyruvate + NH(3) + NADH. The enzyme participates in taurine and hypotaurine metabolism and reductive carboxylate cycle (CO2 fixation). The structure of the enzyme homologue with bound NAD from Archaeoglobus has been solved 1OMO.
Ligand Summary
References