.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vl5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of hypothetical protein (BH2331) from Bacillus halodurans at 1.95 A resolution. To be published
    Site JCSG
    PDB Id 1vl5 Target Id 356107
    Molecular Characteristics
    Source Bacillus halodurans c-125
    Alias Ids TPS1356,10174951 Molecular Weight 28259.65 Da.
    Residues 247 Isoelectric Point 6.23
    Sequence yvtsqihakgsdlaklmqiaalkgneevldvatggghvanafapfvkkvvafdltedilkvarafiegn ghqqveyvqgdaeqlpftderfhivtcriaahhfpnpasfvseayrvlkkggqlllvdnsapendafdv fynyvekerdyshhrawkksdwlkmleeagfeleelhcfhktfifedwcdrmnvttekkqelsdfiksk pteyyqkfkivvedgrvysfrgesilmkarkptvknkgss
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.95 Rfree 0.20882
    Matthews' coefficent 2.64 Rfactor 0.17726
    Waters 634 Solvent Content 53.04

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The gene BH2331 (10174951) from Bacillus halodurans encodes putative S-adenosylmethionine-dependent methyltransferase (SAM or AdoMet-MTase) class I.  AdoMet-MTase uses S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy). There are at least five structurally distinct families of AdoMet-MTases, class I being the largest and most diverse. Within this class, the enzymes can be classified by different substrate specificities (small molecules, lipids, nucleic acids, etc.) and different target atoms for methylation (nitrogen, oxygen, carbon, sulfur, etc.).  The protein reveals fold type characteristic of UbiE/COQ5-like methyltransferase family PF01209 SCOP110671.  This protein is structurally similar to uncharacterized protein YcgJ from Bacillus subitilis 1XXL.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch