.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vkn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of N-acetyl-gamma-glutamyl-phosphate reductase (TM1782) from Thermotoga maritima at 1.80 A resolution. To be published
    Site JCSG
    PDB Id 1vkn Target Id 283635
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1315,TM1782, 89512 Molecular Weight 37933.69 Da.
    Residues 339 Isoelectric Point 6.04
    Sequence miragiigatgytglelvrllknhpeakitylssrtyagkkleeifpstlensilsefdpekvskncdv lftalpagasydlvrelkgvkiidlgadfrfddpgvyrewygkelsgyenikrvyglpelhreeiknaq vvgnpgcyptsvilalapalkhnlvdpetilvdaksgvsgagrkekvdylfsevneslrpynvakhrhv pemeqelgkisgkkvnvvftphlvpmtrgilstiyvktdksleeiheaylefyknepfvhvlpmgiyps tkwcygsnhvfigmqmeertntlilmsaidnlvkgasgqavqnmnimfgldetkgleftpiyp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.80 Rfree 0.21182
    Matthews' coefficent 2.28 Rfactor 0.17766
    Waters 756 Solvent Content 46.17

    Pathway

    Reactions found in Metabolic Reconstruction for TM1782

    Name: N-acetyl-g-glutamyl-phosphate reductase
    Metabolic Subsystem: Arginine Biosynthesis
    Reaction: : acg5sa + nadp + pi <==> acg5p + h + nadph
    Classification: EC:1.2.1.38
     

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1vkn
    1. The Buccaneer software for automated model building. 1. Tracing protein chains
    K Cowtan - Acta Crystallographica Section D: Biological , 2006 - scripts.iucr.org
     
    2. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    3. On the combination of molecular replacement and single-wavelength anomalous diffraction phasing for automated structure determination
    S Panjikar, V Parthasarathy, VS Lamzin - Section D: Biological , 2009 - scripts.iucr.org
     
    4. High throughput crystallography of TB drug targets
    AC Murillo, HY Li, T Alber, EN Baker - Current Drug Targets , 2007 - ingentaconnect.com
     
    5. Fitting molecular fragments into electron density
    K Cowtan - Acta Crystallographica Section D: Biological , 2007 - scripts.iucr.org
     
    6. High-throughput protein production for X-ray crystallography and use of size exclusion chromatography to validate or refute computational biological unit predictions
    D McMullan, JM Canaves, K Quijano - Journal of structural and , 2005 - Springer
     
    7. Crystal Structure of N-acetyl-_-glutamyl-phosphate Reductase from Mycobacterium tuberculosis in Complex with NADP+
    LT Cherney, MM Cherney, CR Garen, C Niu - Journal of molecular , 2007 - Elsevier
     
    8. Crystal structure of putative N_Acetyl___glutamyl_phosphate reductase (AK071544) from rice (Oryza sativa)
    T Nonaka, A Kita, J Miura_Ohnuma - Proteins: Structure, , 2005 - Wiley Online Library
     
    9. Expression, purification, crystallization and preliminary X-ray analysis of two arginine-biosynthetic enzymes from Mycobacterium tuberculosis
    F Moradian, C Garen, L Cherney - Section F: Structural , 2006 - scripts.iucr.org
     
    10. Improved expression, purification and crystallization of a putative N-acetyl--glutamyl-phosphate reductase from rice (Oryza sativa)
    J Miura-Ohnuma, T Nonaka, S Katoh - Section F: Structural , 2005 - scripts.iucr.org
     
    11. Molecular replacement: the probabilistic approach of the program REMO09 and its applications
    R Caliandro, B Carrozzini, GL Cascarano - A: Foundations of , 2009 - scripts.iucr.org
     
    12. Performance of phased rotation, conformation and translation function: accurate protein model building with tripeptidic and tetrapeptidic fragments
    F Pavelcik, J Vaclavik - Acta Crystallographica Section D: Biological , 2010 - scripts.iucr.org
     

    Protein Summary

    The gene TM1782 from Thermotoga maritima encodes the enzyme N-acetyl-gamma-glutamyl-phosphate reductase PF01118 COG0014. Alternative names: N-acetylglutamate 5-semialdehyde dehydrogenase, N-acetylglutamic gamma-semialdehyde dehydrogenase.  The enzyme belongs to the class of alpha and beta proteins and reveals NAD(P)-binding Rossmann-fold domain fold type SCOP51734.  The enzyme participates in urea cycle and metabolism of amino groups. 

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch