.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vkm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of an indigoidine synthase A (IndA)-like protein (TM1464) from Thermotoga maritima at 1.90 A resolution reveals a new fold. Proteins 59 864-868 2005
    Site JCSG
    PDB Id 1vkm Target Id 283322
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1290,TM1464, 84827 Molecular Weight 31726.41 Da.
    Residues 285 Isoelectric Point 5.48
    Sequence miiesriekgkpvvgmettvfvhglprkeaielfrrakeisrekgfqlavigilkgkivagmseeelea mmregadkvgtreipivvaegknaattvsatiflsrrigievvvtggtggvhpgrvdvsqdltemsssr avlvssgiksildveatfemletleiplvgfrtnefplffsrksgrrvprienveevlkiyesmkemel ektlmvlnpvpeeyeiphdeierllekielevegkevtpfllkklvemtngrtlkanlalleenvklag eiavklkrs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 1.90 Rfree 0.19959
    Matthews' coefficent 2.06 Rfactor 0.15384
    Waters 987 Solvent Content 40.36

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1vkm
    1. The Buccaneer software for automated model building. 1. Tracing protein chains
    K Cowtan - Acta Crystallographica Section D: Biological , 2006 - scripts.iucr.org
     
    2. Crystal structure of an indigoidine synthase A (IndA)_like protein (TM1464) from Thermotoga maritima at 1.90 resolution reveals a new fold
    I Levin, MD Miller, R Schwarzenbacher - Proteins: Structure, , 2005 - Wiley Online Library
     
    3. A new approach to assess and predict the functional roles of proteins across all known structures
    ES Julfayev, RJ McLaughlin, YP Tao - Journal of structural and , 2011 - Springer
     

    Protein Summary

    TM1464 encodes an indigoidine synthase A (IdgA)-like protein from Thermotoga maritima (pfam04227; COG2313). Indigoidine is a blue pigment first described in Erwinia chrysanthemi implicated in pathogenicity and protection from oxidative stress [Ref]. IdgA is involved in indigoidine biosynthesis, but its specific function is unknown. Analysis of TM1464 genome context indicates a functional link (score 0.825) with TM1465, a cob(I)alamin adenosyltransferase.

    TM1464 structure, 1vkm, represents a novel fold (Indigoidine synthase A-like; SCOP sunid:110580), with a 3 layers (alpha/beta/alpha) core containing a parallel beta-sheet of 7 strands (order: 2134756). A DALI search returns no significant hits.

    Analysis of the crystallographic packing of 1vkm using the PQS server {Henrick, 1998 #73} indicates that an hexamer is the biologically relevant form.

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch