.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vkh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of an alpha/beta serine hydrolase (YDR428C) from Saccharomyces cerevisiae at 1.85 A resolution. Proteins 58 755-758 2005
    Site JCSG
    PDB Id 1vkh Target Id 354901
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS1343,YDR428C Molecular Weight 29989.75 Da.
    Residues 261 Isoelectric Point 5.17
    Sequence msntvraispditlfnktltfqeisqntreaviyihggawndpentpndfnqlantiksmdtestvcqy sieyrlspeitnprnlydavsnitrlvkekgltninmvghsvgatfiwqilaalkdpqekmseaqlqml gllqivkrvflldgiyslkellveypeydcftrlafpdgiqmyeeepsrvmpyvkkalsrfsidmhlvh sysdelltlrqtnclisclqdyqlsfklylddlglhndvykngkvakyifdnic
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.85 Rfree 0.1894
    Matthews' coefficent 1.93 Rfactor 0.14292
    Waters 458 Solvent Content 35.81

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1vkh
    1. The Buccaneer software for automated model building. 1. Tracing protein chains
    K Cowtan - Acta Crystallographica Section D: Biological , 2006 - scripts.iucr.org
     
    2. Protein function prediction using local 3D templates
    RA Laskowski, JD Watson, JM Thornton - Journal of Molecular Biology, 2005 - Elsevier
     
    3. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    4. Crystal structure of homoserine transacetylase from Haemophilus influenzae reveals a new family of _/_-hydrolases
    IA Mirza, I Nazi, M Korczynska, GD Wright - Biochemistry, 2005 - ACS Publications
     
    5. Identification of formyl kynurenine formamidase and kynurenine aminotransferase from Saccharomyces cerevisiae using crystallographic, bioinformatic and
    M Wogulis, ER Chew, PD Donohoue, DK Wilson - Biochemistry, 2008 - ACS Publications
     
    6. Structural basis of poly (3-hydroxybutyrate) hydrolysis by PhaZ7 depolymerase from Paucimonas lemoignei
    AC Papageorgiou, S Hermawan, CB Singh - Journal of molecular , 2008 - Elsevier
     
    7. Autoindexing with outlier rejection and identification of superimposed lattices
    NK Sauter, BK Poon - Journal of Applied Crystallography, 2010 - scripts.iucr.org
     
    8. Crystal structure of an _/_ serine hydrolase (YDR428C) from Saccharomyces cerevisiae at 1.85 resolution
    JW Arndt, R Schwarzenbacher, R Page - Proteins: Structure, , 2005 - Wiley Online Library
     
    9. A novel structural motif and structural trees for proteins containing it
    AM Kargatov, AV Efimov - Biochemistry (Moscow), 2010 - Springer
     
    10. The crystal structure of an esterase from the hyperthermophilic microorganism Pyrobaculum calidifontis VA1 explains its enantioselectivity
    GJ Palm, E Fernndez-lvaro, X Bogdanovi_ - Applied microbiology , 2011 - Springer
     
    11. Structure of XC6422 from Xanthomonas campestris at 1.6 A resolution: a small serine/-hydrolase
    CY Yang, KH Chin, CC Chou, AHJ Wang - Section F: Structural , 2006 - scripts.iucr.org
     

    Protein Summary

    YDR428C from Saccharomyces cerevisiae, encodes serine hydrolase, protein associated associated with human diseases such as autism, goiter, increased risk factor of late onset Alzheimer disease, and xenobiotic sensitivities, including hypersensitivity to acetylcholinesterase inhibitors (PubMed:15624212).

    Selected structural neighbours of YDR428C found with FATCAT server: 2c7bA, 1lzkA, 1jjiA, 1evqA, and 1jkmB.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch