.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vk6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of NADH pyrophosphatase (1790429) from Escherichia coli k12 at 2.20 A resolution. To be published
    Site JCSG
    PDB Id 1vk6 Target Id 355840
    Related PDB Ids 2gb5 
    Molecular Characteristics
    Source Escherichia coli k12
    Alias Ids TPS1352,1790429 Molecular Weight 29772.58 Da.
    Residues 257 Isoelectric Point 5.63
    Sequence mdriiekldhgwwvvsheqklwlpkgelpygeranfdlvgqralqigewqgepvwlvqqqrrhdmgsvr qvidldvglfqlagrgvqlaefyrshkycgycghemypsktewamlcshcreryypqiapciivairrd dsillaqhtrhrngvhtvlagfvevgetleqavarevmeesgikvknlryvtsqpwpfpqslmtafmae ydsgdividpkelleanwyryddlpllpppgtvarrliedtvamcraeye
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.21955
    Matthews' coefficent 4.13 Rfactor 0.18668
    Waters 96 Solvent Content 69.99

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The gene 1790429 from Escherichia coli encodes the enzyme NADH pyrophosphatase E.C.3.6.1.22, a member of an NADH pyrophosphatase subfamily of the Nudix hydrolases PF00293.  The enzyme catalyzes the cleavage of NADH into reduced nicotinamide mononucleotide (NMNH) and AMP.  Like other members of the Nudix family, it requires a divalent cation, such as Mg2+ or Mn2+, for activity.  The amino acid motif getleqavarevmeesgis highly conserved among family members and functions as a metal binding and catalytic site.   The E.coli enzyme contains three cleary defined structural domains with specific functions:  a rudimentary NUDIX-like domain PF09296, a NADH pyrophosphatase zinc ribbon domain PF09297, and NUDIX domain. It appears to be the first structure  available with such a quaternary arrangement of these domains.  The structure of this enzyme has  also been solved in a different crystal form 2GB5.  The two structures present a similar dimeric architecture (for 1vk6 the second subunit is generated by crystallographic symmetry). All three domains contribute to the dimerization interface.

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch