The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of PfkB Carbohydrate kinase (TM0415) from Thermotoga maritima at 1.91 A resolution. To be published
    Site JCSG
    PDB Id 1vk4 Target Id 282288
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1202,TM0415, 3.40.1190.20, 282670 Molecular Weight 32059.93 Da.
    Residues 286 Isoelectric Point 6.47
    Sequence mitfighvskdvnvvdgkreiaygggvvmgaitssllgvktkvitkctredvskfsflrdngvevvflk sprttsienrygsdpdtresflisaadpftesdlafiegeavhinplwygefpedlipvlrrkvmflsa daqgfvrvpeneklvyrdwemkekylkyldlfkvdsreaetltgtndlrescriirsfgakiilathas gvivfdgnfyeasfrswslegrtgrgdtctaaflvgfvfkkmsiekatkfaaavtsvkmrhpgplrred leaisgdqyf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.91 Rfree 0.21938
    Matthews' coefficent 2.08 Rfactor 0.1676
    Waters 193 Solvent Content 40.46

    Ligand Information


    Google Scholar output for 1vk4
    1. The Buccaneer software for automated model building. 1. Tracing protein chains
    K Cowtan - Acta Crystallographica Section D: Biological , 2006 - scripts.iucr.org
    2. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
    3. CAMPO, SCR_FIND and CHC_FIND: a suite of web tools for computational structural biology
    A Paiardini, F Bossa, S Pascarella - Nucleic acids research, 2005 - Oxford Univ Press

    Protein Summary

    The TM0415 gene of Thermotoga maritima encodes a PfkB carbohydrate kinase (PF00294, COG0524, EC The TM0415 structure exhibits a ribokinase-like fold.

    Ligand Summary





    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch