.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vjv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of Ubiquitin carboxyl-terminal hydrolase 6 (yfr010w) from Saccharomyces cerevisiae at 1.74 A resolution. To be published
    Site JCSG
    PDB Id 1vjv Target Id 355004
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS1345,YFR010W Molecular Weight 57107.88 Da.
    Residues 499 Isoelectric Point 6.71
    Sequence msgetfefnirhsgkvypitlstdatsadlkskaeeltqvpsarqkymvkgglsgeesikiyplikpgs tvmllgtpdanliskpakknnfiedlapeqqvqqfaqlpvgfknmgntcylnatlqalyrvndlrdmil nynpsqgvsnsgaqdeeihkqiviemkrcfenlqnksfksvlpivllntlrkcypqfaerdsqggfykq qdaeelftqlfhsmsivfgdkfsedfriqfkttikdtandnditvkenesdsklqchisgttnfmrngl leglnekiekrsdltgansiysvekkisrlpkfltvqyvrffwkrstnkkskilrkvvfpfqldvadml tpeyaaekvkvrdelrkvekeknekereikrrkfdpsssenvmtpreqyetqvalnesekdqwleeykk hfppnlekgenpscvynligvithqgansesghyqafirdeldenkwykfnddkvsvvekekieslagg gesdsalilmykgfgl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.74 Rfree 0.20892
    Matthews' coefficent 2.14 Rfactor 0.17917
    Waters 241 Solvent Content 42.44

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    UBP6 from Saccharomyces cerevisiae is a cysteine peptidase (EC:3.1.2.15) and contains two domains - an N-terminal ubiquitin (Ub) domain and a C-terminal catalytic domain. The crystal structure corresponds to the catalytic domain of UBP6 which belongs to the C.19.079 family of MEROPS database.  The cysteine peptidase deubiquitinating enzyme (DUBs) family can be further subdivided into four subfamilies namely the Ub-specific protease (USP), Ub C-terminal hydrolase (UCH), Otubain protease (OTU) and Machado-Joseph disease protease (MJD). UBP6 belongs to the USP subfamily which is the largest and most diverse among the DUBs. The catalytic triad of this cysteine peptidase is comprised of residues C118, H447 and N465. N113 is also in the vicinity of the active site. In addition the UBP6 protein has a degraded zinc ribbon motif (unlikely to bind zinc in UBP6) inserted between structural elements of the peptidase core. The presence of the zinc ribbon was predicted by Krishna and Grishin (2004) based on the structure of the human protein HAUSP {ref Cell cycle 2004}. The structure of the homologous USP8 contains an intact zinc-binding ribbon. Crystallographic packing indicates UBP6 to be a monomer.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch