.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vjt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of Alpha-glucosidase (TM0752) from Thermotoga maritima at 2.50 A resolution. To be published
    Site JCSG
    PDB Id 1vjt Target Id 282622
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1231,TM0752 Molecular Weight 55354.60 Da.
    Residues 471 Isoelectric Point 5.85
    Sequence mkisiigagsvrfalqlvgdiaqteelsredthiymmdvherrlnasyilarkyveelnspvkivktss ldeaidgadfiintaypydpryhdsgsqrwdevtkvgekhgyyrgidsqelnmvstytyvlssypdmkl aleiaekmkkmapkaylmqtanpvfeitqavrrwtganivgfchgvagvyevfekldldpeevdwqvag vnhgiwlnrfryrgedayplldewiekklpewepknpwdtqmspaamdmykfygmlpigdtvrngswky hynletkkkwfgkfggidneverpkfheqlrrarerliklaeevqqnpgmklteehpeifpkgklsgeq hipfinaiannkrvrlflnvenqgtlkdfpddvvmelpvwvdccgihrekvepdlthrikifylwpril rmewnleayisrdrkvleeilirdprtksyeqivqvldeifnlpfneelrryykekl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.25602
    Matthews' coefficent 2.38 Rfactor 0.1944
    Waters 48 Solvent Content 47.87

    Pathway

    Reactions found in Metabolic Reconstruction for TM0752

    Name: sucrose hydrolyzing enzyme
    Other genes that carryout this rxn: TM1068 TM1414
    Metabolic Subsystem: Sucrose Metabolism
    Reaction: : h2o + sucr --> fru + glc-D
    Classification: EC:3.2.1.26
     

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    The TM0752 gene from Thermotoga maritima encodes a 6-phospho-alpha-glycosidase belonging to the family 4 glycosyl hydrolases PF02056 COG0366.  Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety.  Glycoside hydrolase family 4 comprises enzymes with several known activities: 6-phospho-beta-glucosidases, 6-phospho-alpha-glucosidase, alpha-galactosidases.  6-phospho-alpha-glucosidase requires both NAD(H) and divalent metal (Mn2+, Fe2+, Co2+, or Ni2+) for activity [Ref].  Thus, the TM0752 codes for NAD(H)-dependent 6-phospho-alpha-glycosidase.  The crystal structure of a possible isoform of this enzyme from the same organism has been reported (1OBB).

    Ligand Summary



    References

    Reviews

    References

     

    1. Thompson J, Pikis A, Ruvinov SB, Henrissat B, Yamamoto H, and Sekiguchi J The gene glvA of Bacillus subtilis 168 encodes a metal-requiring, NAD(H)-dependent 6-phospho-alpha-glucosidase. Assignment to family 4 of the glycosylhydrolase superfamily. J Biol Chem. 1998 Oct 16; 273(42):27347-56 PubMed HubMed pmid:9765262.

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch