The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Alpha-glucosidase (TM0752) from Thermotoga maritima at 2.50 A resolution. To be published
    Site JCSG
    PDB Id 1vjt Target Id 282622
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1231,TM0752, 422573 Molecular Weight 55354.60 Da.
    Residues 471 Isoelectric Point 5.85
    Sequence mkisiigagsvrfalqlvgdiaqteelsredthiymmdvherrlnasyilarkyveelnspvkivktss ldeaidgadfiintaypydpryhdsgsqrwdevtkvgekhgyyrgidsqelnmvstytyvlssypdmkl aleiaekmkkmapkaylmqtanpvfeitqavrrwtganivgfchgvagvyevfekldldpeevdwqvag vnhgiwlnrfryrgedayplldewiekklpewepknpwdtqmspaamdmykfygmlpigdtvrngswky hynletkkkwfgkfggidneverpkfheqlrrarerliklaeevqqnpgmklteehpeifpkgklsgeq hipfinaiannkrvrlflnvenqgtlkdfpddvvmelpvwvdccgihrekvepdlthrikifylwpril rmewnleayisrdrkvleeilirdprtksyeqivqvldeifnlpfneelrryykekl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.25602
    Matthews' coefficent 2.38 Rfactor 0.1944
    Waters 48 Solvent Content 47.87


    Reactions found in Metabolic Reconstruction for TM0752

    Name: sucrose hydrolyzing enzyme
    Other genes that carryout this rxn: TM1068 TM1414
    Metabolic Subsystem: Sucrose Metabolism
    Reaction: : h2o + sucr --> fru + glc-D
    Classification: EC:

    Ligand Information


    Google Scholar output for 1vjt
    1. NAD+ and Metal-ion Dependent Hydrolysis by Family 4 Glycosidases: Structural Insight into Specificity for Phospho-_-d-glucosides
    A Varrot, VLY Yip, Y Li, SS Rajan, X Yang - Journal of molecular , 2005 - Elsevier
    2. Breakdown of oligosaccharides by the process of elimination
    VLY Yip, SG Withers - Current opinion in chemical biology, 2006 - Elsevier
    3. Shotgun crystallization strategy for structural genomics II: crystallization conditions that produce high resolution structures for T. maritima proteins
    R Page, AM Deacon, SA Lesley - Journal of structural and , 2005 - Springer
    4. High-throughput protein production for X-ray crystallography and use of size exclusion chromatography to validate or refute computational biological unit predictions
    D McMullan, JM Canaves, K Quijano - Journal of structural and , 2005 - Springer
    5. Family 4 glycoside hydrolases are special: the first _-elimination mechanism amongst glycoside hydrolases
    VLY Yip, SG Withers - Biocatalysis and Biotransformation, 2006 - informahealthcare.com
    6. A fold-recognition approach to loop modeling
    C Levefelt, D Lundh - Journal of molecular modeling, 2006 - Springer

    Protein Summary

    The TM0752 gene from Thermotoga maritima encodes a 6-phospho-alpha-glycosidase belonging to the family 4 glycosyl hydrolases PF02056 COG0366.  Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety.  Glycoside hydrolase family 4 comprises enzymes with several known activities: 6-phospho-beta-glucosidases, 6-phospho-alpha-glucosidase, alpha-galactosidases.  6-phospho-alpha-glucosidase requires both NAD(H) and divalent metal (Mn2+, Fe2+, Co2+, or Ni2+) for activity [Ref].  Thus, the TM0752 codes for NAD(H)-dependent 6-phospho-alpha-glycosidase.  The crystal structure of a possible isoform of this enzyme from the same organism has been reported (1OBB).

    Ligand Summary





    1. (No Results)


      Discuss this publication
    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch