| Title | Crystal structure of an alanine-glyoxylate aminotransferase from Anabaena sp. at 1.70 A resolution reveals a noncovalently linked PLP cofactor. Proteins 58 971-975 2005 | | Site | JCSG | | PDB Id | | Target Id | 354073 | | Molecular Characteristics | | Source | Nostoc sp. pcc 7120 | | Alias Ids | TPS1319,17130350 | Molecular Weight | 41866.81 Da. | | Residues | 381 | Isoelectric Point | 5.78 | | Sequence | maqiisindnqrlqleplevpsrlllgpgpsnahpsvlqamnvspvghldpaflalmdeiqsllryvwq tenpltiavsgtgtaameatianavepgdvvligvagyfgnrlvdmagrygadvrtiskpwgevfslee lrtalethrpailalvhaetstgarqplegvgelcrefgtlllvdtvtslggvpifldawgvdlayscs qkglgcspgaspftmssraieklqrrrtkvanwyldmnllgkywgservyhhtapinlyyalrealrli aqeglancwqrhqknveylwerlediglslhvekeyrlptlttvcipdgvdgkavarrllnehnievgg glgelagkvwrvglmgfnsrkesvdqlipaleqvlr | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.70 | Rfree | 0.20182 | | Matthews' coefficent | 2.06 | Rfactor | 0.15135 | | Waters | 432 | Solvent Content | 39.95 |
| Ligand Information | | Ligands | | | Metals | | | |
Protein Summary
Alanine-glyoxylate aminotransferase (AGT) from Anabaena sp. (EC 2.6.1.44; COG0075, Pfam00266) is a pyridoxal-phosphate (PLP) dependent enzyme involved in serine-glycine metabolism, where it catalyses the transamination of L-alanine and glyoxylate to pyruvate and glycine.
The protein shows close structural resemblance with the human alanine:glyoxylate aminotransferase. In humans, where AGT is peroxisomal, a single point mutation miss-localizes the protein to the mitochondrion, leading to the hereditary kidney stone disease: primary hyperoxaluria type 1 (PubMed:12686111). AGT peroxisomal or mitochondrial location is species-dependent and related to diet in mammals (PubMed:14739251).
Anabaena AGT forms dimer in crystal structure; where each monomer has fold of PLP-dependent transferases (SCOP sunid: 53382). The main N-terminal domain has 3 layers: ???, mixed ?-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest. The C-terminal domain is a 2-layer ?? structure, with the 3-stranded, antiparallel ?-sheet packs against the edge of the N-terminal domain (PubMed:15657930).
Ligand Summary
References