.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vjo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of an alanine-glyoxylate aminotransferase from Anabaena sp. at 1.70 A resolution reveals a noncovalently linked PLP cofactor. Proteins 58 971-975 2005
    Site JCSG
    PDB Id 1vjo Target Id 354073
    Molecular Characteristics
    Source Nostoc sp. pcc 7120
    Alias Ids TPS1319,17130350 Molecular Weight 41866.81 Da.
    Residues 381 Isoelectric Point 5.78
    Sequence maqiisindnqrlqleplevpsrlllgpgpsnahpsvlqamnvspvghldpaflalmdeiqsllryvwq tenpltiavsgtgtaameatianavepgdvvligvagyfgnrlvdmagrygadvrtiskpwgevfslee lrtalethrpailalvhaetstgarqplegvgelcrefgtlllvdtvtslggvpifldawgvdlayscs qkglgcspgaspftmssraieklqrrrtkvanwyldmnllgkywgservyhhtapinlyyalrealrli aqeglancwqrhqknveylwerlediglslhvekeyrlptlttvcipdgvdgkavarrllnehnievgg glgelagkvwrvglmgfnsrkesvdqlipaleqvlr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.20182
    Matthews' coefficent 2.06 Rfactor 0.15135
    Waters 432 Solvent Content 39.95

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Alanine-glyoxylate aminotransferase (AGT) from Anabaena sp. (EC 2.6.1.44; COG0075, Pfam00266) is a pyridoxal-phosphate (PLP) dependent enzyme involved in serine-glycine metabolism, where it catalyses the transamination of L-alanine and glyoxylate to pyruvate and glycine.

    The protein shows close structural resemblance with the human alanine:glyoxylate aminotransferase. In humans, where AGT is peroxisomal, a single point mutation miss-localizes the protein to the mitochondrion, leading to the hereditary kidney stone disease: primary hyperoxaluria type 1 (PubMed:12686111). AGT peroxisomal or mitochondrial location is species-dependent and related to diet in mammals (PubMed:14739251).

    Anabaena AGT forms dimer in crystal structure; where each monomer has fold of PLP-dependent transferases (SCOP sunid: 53382). The main N-terminal domain has 3 layers: ???, mixed ?-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest. The C-terminal domain is a 2-layer ?? structure, with the 3-stranded, antiparallel ?-sheet packs against the edge of the N-terminal domain (PubMed:15657930).


    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch