.
The Open Protein Structure Annotation Network
PDB Keyword
.
Blog
Tools
About
Logged in: Logged in as: Log in
Register

New Features

Quick Links

Page Authors

 

T. maritima Browser

TOPSAN > Proteins > JCSG > 1vjl

1vjl

    Page last modified 22:14, 25 Oct 2010 by Admin
    Email link
    Page Notifications Off
    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title On the use of DXMS to produce more crystallizable proteins: structures of the T. maritima proteins TM0160 and TM1171. Protein Sci. 13 3187-3199 2004
    Site JCSG
    PDB Id 1vjl Target Id 282040
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1186,TM0160 Molecular Weight 20550.23 Da.
    Residues 181 Isoelectric Point 4.52
    Sequence mrkawvktlaldrvsntpvvilgiegtnrvlpiwigaceghalalamekmefprplthdlllsvlesle arvdkviihslkdntfyatlvirdltytdeedeeaalididsrpsdaiilavktgapifvsdnlvekhs ielevnetqdeeeefkkfvenlnidtfkqmiekkreedeeges
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.253
    Matthews' coefficent 2.45 Rfactor 0.198
    Waters 164 Solvent Content 49.30

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The TM0160 gene ( PF02577, cl00553) from Thermotoga maritima MSB8 encodes for the NP_227975 protein of unknown function (DUF151). Hits detected by HHpred and FFAS are not reliable enough to derive a meaningful annotation. Analysis of its genome context shows (score 0.87) the presence of a geranyltrans-transferase (TM0161).

    1vjl is the first structure of this family to be experimentally determined and revealed a novel fold (SCOP alpha+beta class, TM0160 fold). DALI only very weak hit (Z=4) is with the NE1496 protein 2fbl. This family has been brought into connection with the DNA damage recognition domain DVR [Ref]. PDB structure 1VJL replaced 1O5Y. PDB structure 1VJL contains the sequence of 1SJ5.

    Ligand Summary



    References

    Reviews References Images Files Tags

    Reviews

    References

     

    1. You MK, Shin HY, Kim YJ, Ok SH, Cho SK, Jeung JU, Yoo SD, Kim JK, and Shin JS Novel bifunctional nucleases, OmBBD and AtBBD1, are involved in abscisic acid-mediated callose deposition in Arabidopsis. Plant Physiol. 2010 Feb; 152(2):1015-29 PubMed HubMed doi:10.1104/pp.109.147645 pmid:20018603.

       


      Discuss this publication
    Add tag
    Tag page
    What links here
    Attach file or image

    Files (0)

     
    Attach file or image

    Images (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch