| Title | Crystal structure of putative lipase from the G-D-S-L family from Nostoc sp. at 2.01 A resolution. To be published | | Site | JCSG | | PDB Id | | Target Id | 354318 | | Related PDB Ids 1z8h | | Molecular Characteristics | | Source | Nostoc sp. pcc 7120 | | Alias Ids | TPS1915,17135349 | Molecular Weight | 23594.68 Da. | | Residues | 206 | Isoelectric Point | 8.30 | | Sequence | mtkqsktqiricfvgdsfvngtgdpeclgwtgrvcvnankkgydvtyynlgirrdtssdiakrwlqevs lrlhkeynslvvfsfglndttlengkprvsiaetikntreiltqakklypvlmispapyieqqdpgrrr rtidlsqqlalvcqdldvpyldvfpllekpsvwlheakandgvhpqaggytefarivenwdawlnwfr | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.01 | Rfree | 0.21832 | | Matthews' coefficent | 2.43 | Rfactor | 0.17247 | | Waters | 93 | Solvent Content | 48.97 |
| Ligand Information | | Ligands | | | Metals | | | |
Protein Summary
The alr1529 gene from Nostoc sp. PCC 7120 encodes for a GDSL-like lipase. JCSG has refined this protein structure in two crystal forms, this entry describes space group P 32 2 1, the second entry, 1z8h, describes space group P 21 21 21 and contains an unknown intermediate near the active site. We refer the reader to this entry for more information.
Ligand Summary
References
