.
The Open Protein Structure Annotation Network
PDB Keyword
.
Blog
Tools
About
Logged in: Logged in as: Log in
Register

New Features

Quick Links

Page Authors

 

T. maritima Browser

TOPSAN > Proteins > JCSG > 1vjf

1vjf

    Page last modified 23:10, 25 Oct 2010 by Admin
    Email link
    Page Notifications Off
    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of putative DNA-binding protein from Caulobacter crescentus at 1.62 A resolution. To be published
    Site JCSG
    PDB Id 1vjf Target Id 355823
    Molecular Characteristics
    Source Caulobacter crescentus cb15
    Alias Ids TPS1351,13421216 Molecular Weight 18262.15 Da.
    Residues 168 Isoelectric Point 6.14
    Sequence mktradlfaffdahgvdhktldhppvfrveegleikaampgghtknlflkdakgqlwlisalgettidl kklhhvigsgrlsfgpqemmletlgvtpgsvtafglindtekrvrfvldkaladsdpvnfhplkndatt avsqaglrrflaalgvepmivdfaamevvg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.62 Rfree 0.16673
    Matthews' coefficent 1.87 Rfactor 0.14488
    Waters 176 Solvent Content 33.73

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The gene CC_0111 from Caulobacter crescentus encodes the NP_418930 protein with a putative conserved domain of PrdX deacylase. Its sequence is 58% identical to YP_758156,  an Ala-tRNA(Pro) hydrolase. NP_418930 belongs to the YbaK PF04073 and ProX proteins, and the prolyl-tRNA synthetase-editing domain (ProRS-INS). PrdX deacylase specifically hydrolyzes Ala-tRNA(Pro).

    1vjf belongs to the class of alpha and beta (a+b) proteins and reveals  YbaK/ProRS associated domain fold type SCOP55825. A Dali search with 1vjf provides a top hit (Z-scr=25) with the structure of hypothetical protein ATU3699 from Agrobacterium tumefaciens  1VKI. A second hit (Z-scr=14) with the cysteinyl-tRNA(Pro) deacylase 1dbu.

    Ligand Summary



    References

    Reviews References Images Files Tags

    Reviews

    References

     

    No references found.

    Add tag
    Tag page
    What links here
    Attach file or image

    Files (0)

     
    Attach file or image

    Images (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch