.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vj2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of a novel manganese-containing cupin (TM1459) from Thermotoga maritima at 1.65 A resolution. Proteins 56 611-614 2004
    Site JCSG
    PDB Id 1vj2 Target Id 283317
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1289,TM1459 Molecular Weight 13108.44 Da.
    Residues 114 Isoelectric Point 5.60
    Sequence milkraydvtpqkistdkvrgvrkrvliglkdapnfvmrlftvepgglidrhshpweheifvlkgkltv lkeqgeetveegfyifvepneihgfrndtdseveflclipkegge
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.65 Rfree 0.24859
    Matthews' coefficent 2.71 Rfactor 0.20817
    Waters 169 Solvent Content 54.20

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Gene TM1459 from Thermotoga Maritima encodes the protein NP_229258 whose structure (1vj2) is the first representative of a novel subfamily of cupins (PF07883) containing manganese that is coordinated by four histidines (His52, His54, His58, and His92) [Ref].

    TM1459 has similar phylogenetic cooccurrence (string.embl.de) as TM0243 (a member of SAM radical superfamily).

    1vj2 classifies inside the SCOP all beta class, RmlC-like cupins superfamily, TM1459 family. DALI top hits are with the RemF polyketide cyclase PDB:3ht1 (Z=17), a putative oxalate decarboxylase PDB:1o4t (Z=16), and the cupin-2 protein PDB:2pfw (Z=15). RemF also has significant (36%) sequence homology to TM1459 but shows a two-helix C-terminal extension of unknown function. Despite very similar coordination chemistry and geometry, the metal in RemF was identified as zinc or nickel, depending on the crystallization conditions [Ref].

    Analysis of the crystallographic packing of 1vj2 using the PQS server {Henrick, 1998 #73} indicates that a dimer is the biologically relevant form. The N-terminal beta-strand is part of the beta-sheet of the opposite subunit, suggesting a bona fide dimer.

    PDB entry 1o5n was replaced by 1vj2

    Ligand Summary



    References

    Reviews

    References

     

    1. Jaroszewski L, Schwarzenbacher R, von Delft F, McMullan D, Brinen LS, Canaves JM, Dai X, Deacon AM, DiDonato M, Elsliger MA, Eshagi S, Floyd R, Godzik A, Grittini C, Grzechnik SK, Hampton E, Levin I, Karlak C, Klock HE, Koesema E, Kovarik JS, Kreusch A, Kuhn P, Lesley SA, McPhillips TM, Miller MD, Morse A, Moy K, Ouyang J, Page R, Quijano K, Reyes R, Rezezadeh F, Robb A, Sims E, Spraggon G, Stevens RC, van den Bedem H, Velasquez J, Vincent J, Wang X, West B, Wolf G, Xu Q, Hodgson KO, Wooley J, and Wilson IA Crystal structure of a novel manganese-containing cupin (TM1459) from Thermotoga maritima at 1.65 A resolution. Proteins. 2004 Aug 15; 56(3):611-4 PubMed HubMed doi:10.1002/prot.20130 pmid:15229893.

       


      Discuss this publication
    2. Silvennoinen L, Sandalova T, and Schneider G The polyketide cyclase RemF from Streptomyces resistomycificus contains an unusual octahedral zinc binding site. FEBS Lett. 2009 Sep 3; 583(17):2917-21 PubMed HubMed doi:10.1016/j.febslet.2009.07.061 pmid:19665022.

       


      Discuss this publication
    Tag page

    Files (1)

    FileSizeDateAttached by 
    1o5n.jpg
    No description
    14.63 kB20:09, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch