| Title | Crystal structure of a putative NADPH-dependent oxidoreductase (GI: 18204011) from mouse at 2.10 A resolution. Proteins 56 629-633 2004 | | Site | JCSG | | PDB Id | | Target Id | 354739 | | Molecular Characteristics | | Source | Mus musculus | | Alias Ids | TPS1339,18204011 | Molecular Weight | 38052.47 Da. | | Residues | 351 | Isoelectric Point | 5.38 | | Sequence | miiqrvvlnsrpgkngnpvaenfrveefslldalnegqvqvrtlylsvdpymrckmnedtgtdylapwq laqvadgggigiveeskhqklakgdfvtsfywpwqtkaildgnglekvdpqlvdghlsyflgaigmpgl tsligvqekghisagsnqtmvvsgaagacgslagqighllgcsrvvgicgtqekclfltselgfdaavn yktgnvaeqlreacpggvdvyfdnvggdisntvisqmnenshiilcgqisqynkdvpyppplppaveai rkernitrerftvlnykdkfepgilqlsqwfkegklkvketvakglenmgvafqsmmtggnvgkqivci sedssl | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.10 | Rfree | 0.216 | | Matthews' coefficent | 2.60 | Rfactor | 0.18 | | Waters | 153 | Solvent Content | 51.75 |
| Ligand Information | | Ligands | | | Metals | | | |
Protein Summary
Structure of putative NADPH-dependent oxidoreductase (GI:18204011; COG2130; Pfam00107) from Mouse comprises two distinct domains: the catalytic domain (residues 1-132; 311-351) and the nucleotide-binding domain (residues 133-310). Structure of the catalytic domain has GroES-like fold (SCOP sunid:50128) and belongs to alcohol dehydrogenase-like family (SCOP sunid:50136). The nucleotide-binding domain has NAD(P)-binding Rossmann-fold domains (SCOP sunid:51734; 3 layers - a/b/a, where parallel beta-sheet of 6 strands has order 321456).
Structural comparison with quinone oxidoreductase, shows that the large cleft between the two domains in GI:18204011 could easily accommodate an NADPH molecule and suggests a redox mechanism related to that of quinone oxidoreductase (PubMed:
15229897).
Ligand Summary
References