.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vj1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of a putative NADPH-dependent oxidoreductase (GI: 18204011) from mouse at 2.10 A resolution. Proteins 56 629-633 2004
    Site JCSG
    PDB Id 1vj1 Target Id 354739
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS1339,18204011 Molecular Weight 38052.47 Da.
    Residues 351 Isoelectric Point 5.38
    Sequence miiqrvvlnsrpgkngnpvaenfrveefslldalnegqvqvrtlylsvdpymrckmnedtgtdylapwq laqvadgggigiveeskhqklakgdfvtsfywpwqtkaildgnglekvdpqlvdghlsyflgaigmpgl tsligvqekghisagsnqtmvvsgaagacgslagqighllgcsrvvgicgtqekclfltselgfdaavn yktgnvaeqlreacpggvdvyfdnvggdisntvisqmnenshiilcgqisqynkdvpyppplppaveai rkernitrerftvlnykdkfepgilqlsqwfkegklkvketvakglenmgvafqsmmtggnvgkqivci sedssl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.216
    Matthews' coefficent 2.60 Rfactor 0.18
    Waters 153 Solvent Content 51.75

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Structure of putative NADPH-dependent oxidoreductase (GI:18204011; COG2130; Pfam00107) from Mouse comprises two distinct domains: the catalytic domain (residues 1-132; 311-351) and the nucleotide-binding domain (residues 133-310). Structure of the catalytic domain has GroES-like fold (SCOP sunid:50128) and  belongs to alcohol dehydrogenase-like family (SCOP sunid:50136). The nucleotide-binding domain has NAD(P)-binding Rossmann-fold domains (SCOP sunid:51734; 3 layers - a/b/a, where parallel beta-sheet of 6 strands has order 321456).

    Structural comparison with quinone oxidoreductase, shows that the large cleft between the two domains in GI:18204011 could easily accommodate an NADPH molecule and suggests a redox mechanism related to that of quinone oxidoreductase (PubMed:15229897).

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch