The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title NMR structure determination of the conserved hypothetical protein TM1816 from Thermotoga maritima. Proteins 60 552-557 2005
    Site JCSG
    PDB Id 1t3v Target Id 283669
    Related PDB Ids 1o13 
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1914,TM1816, 89497 Molecular Weight 13624.70 Da.
    Residues 124 Isoelectric Point 6.18
    Sequence miiaipvsenrgkdspisehfgrapyfafvkvknnaiadisveenplaqdhvhgavpnfvkekgaelvi vrgigrraiaafeamgvkvikgasgtveevvnqylsgqlkdsdyevhdhhhhehh
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1t3v
    1. Microbial biochemistry, physiology, and biotechnology of hyperthermophilic Thermotoga species
    SB Conners, EF Mongodin, MR Johnson - FEMS microbiology , 2006 - Wiley Online Library
    2. A residue at the cytoplasmic entrance of BK-type channels regulating single-channel opening by its hydrophobicity
    Z Guo, C Lv, H Yi, Y Xiong, Y Wu, W Li, T Xu, J Ding - Biophysical journal, 2008 - Elsevier
    3. NMR structure determination of the conserved hypothetical protein TM1816 from Thermotoga maritima
    L Columbus, W Peti, T Etezady_Esfarjani - Proteins: Structure, , 2005 - Wiley Online Library
    4. NMR structure of the protein NP_247299. 1: comparison with the crystal structure
    K Jaudzems, M Geralt, P Serrano - Section F: Structural , 2010 - scripts.iucr.org
    5. Evaluating the solution from MrBUMP and BALBES
    RM Keegan, F Long, VJ Fazio, MD Winn - Section D: Biological , 2011 - scripts.iucr.org
    6. Crystallization and crystallographic analysis of the apo form of the orange protein (ORP) from Desulfovibrio gigas
    S Najmudin, C Bonifacio, AG Duarte - Section F: Structural , 2009 - scripts.iucr.org
    7. Carbohydrate utilization pathway analysis in the hyperthermophile Thermotoga maritima
    SB Conners - 2006 - repository.lib.ncsu.edu
    8. The Anaerobe-Specific Orange Protein Complex of Desulfovibrio vulgaris Hildenborough Is Encoded by Two Divergent Operons Coregulated by _54 and a Cognate
    A Fivet, E Cascales, M Ansaldi, SR Pauleta - Journal of , 2011 - Am Soc Microbiol

    Protein Summary

    The gene TM1816 from Thermotoga maritima encodes the NP_229613 protein, a putative dinitrogenase iron-molybdenum cofactor PF02579. This conserved domain belongs to a family of iron-molybdenum cluster-binding proteins that includes NifX, NifB, and NifY, all of which are involved in the synthesis of an iron-molybdenum cofactor (FeMo-co) that binds the active site of the dinitrogenase enzyme. This domain is present either as a stand-alone domain (e.g. NifX and NifY) or fused to another conserved domain (e.g. NifB). However, its precise function is still undetermined [Ref]. Genome context analysis reveals (score 0.85) the presence of a ferredoxin protein (TM1815) in the vicinity of this target.

    The SCOP database classifies 1t3v in the alpha/beta class, within the ribonuclease H fold, nitrogenase accesory factor-like superfamily, MTH1175-like family (SCOP53146).  The crystal structure of the same protein is available (PDB:1o13). DALI top hits are with the PH0822 protein PDB:2yx6 (Z=15), MJ0327 protein PDB:2qtd (Z=13), and TA1041 protein  PDB:2re2 (Z=12).

    Ligand Summary





    1. (No Results)


      Discuss this publication
    Tag page

    Files (1)

    FileSizeDateAttached by 
    No description
    20.64 kB20:09, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch