| Title | Solution structures of the putative anti-sigma-factor antagonist TM1442 from Thermotoga maritima in the free and phosphorylated states. Magn.Reson.Chem. 44 Spec No S61-S70 2006 | | Site | JCSG | | PDB Id | | Target Id | 283301 | | Related PDB Ids 1t6r | | Molecular Characteristics | | Source | Thermotoga maritima msb8 | | Alias Ids | TPS1288,TM1442 | Molecular Weight | 12299.53 Da. | | Residues | 110 | Isoelectric Point | 5.81 | | Sequence | mnnlkldiveqddkaivrvqgdidaynsselkeqlrnfisttskkkivldlssvsymdsaglgtlvvil kdakingkefilsslkesisrilklthldkifkitdtveea | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | | | |
Protein Summary
The gene TM1442 from Thermotoga maritima encodes an anti-sigma factor antagonist domain of anti-anti-sigma factors (the STAS domain) PF01740 COG1366. The structure of the same protein in the phosphorylated state has been solved PDB:1t6r also by NMR. Anti-anti-sigma factors play an important role in the regulation of several sigma factors and their corresponding anti-sigma factors. Upon dephosphorylation they bind the anti-sigma factor and induce the release of the sigma factor from the anti-sigma factor. In a feedback mechanism the anti-anti-sigma factor can be inactivated via phosphorylation by the anti-sigma factor. Well studied examples from Bacillus subtilis are SpoIIAA (regulating sigmaF and sigmaC which play an important role in sporulation) and RsbV (regulating sigmaB involved in the general stress response) [Ref]. The STAS domain is also found in the C- terminal region of sulphate transporters and stressosomes.
Ligand Summary
References