.
The Open Protein Structure Annotation Network
PDB Keyword
.

1sbo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Solution structures of the putative anti-sigma-factor antagonist TM1442 from Thermotoga maritima in the free and phosphorylated states. Magn.Reson.Chem. 44 Spec No S61-S70 2006
    Site JCSG
    PDB Id 1sbo Target Id 283301
    Related PDB Ids 1t6r 
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1288,TM1442 Molecular Weight 12299.53 Da.
    Residues 110 Isoelectric Point 5.81
    Sequence mnnlkldiveqddkaivrvqgdidaynsselkeqlrnfisttskkkivldlssvsymdsaglgtlvvil kdakingkefilsslkesisrilklthldkifkitdtveea
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The gene TM1442 from Thermotoga maritima encodes an anti-sigma factor antagonist domain of anti-anti-sigma factors (the STAS domain) PF01740 COG1366.  The structure of the same  protein in the phosphorylated state has been solved PDB:1t6r also by NMR.  Anti-anti-sigma factors play an important role in the regulation of several sigma factors and their corresponding anti-sigma factors. Upon dephosphorylation they bind the anti-sigma factor and induce the release of the sigma factor from the anti-sigma factor. In a feedback mechanism the anti-anti-sigma factor can be inactivated via phosphorylation by the anti-sigma factor. Well studied examples from Bacillus subtilis are SpoIIAA (regulating sigmaF and sigmaC which play an important role in sporulation) and RsbV (regulating sigmaB involved in the general stress response) [Ref]. The STAS domain is also found in the C- terminal region of sulphate transporters and stressosomes.

    Ligand Summary


    References

    Reviews

    References

     

    1. Kovacs H, Comfort D, Lord M, Campbell ID, and Yudkin MD Solution structure of SpoIIAA, a phosphorylatable component of the system that regulates transcription factor sigmaF of Bacillus subtilis. Proc Natl Acad Sci U S A. 1998 Apr 28; 95(9):5067-71 PubMed HubMed pmid:9560229.

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch