.
The Open Protein Structure Annotation Network
PDB Keyword
.
Blog
Tools
About
Logged in: Logged in as: Log in
Register

New Features

Quick Links

Page Authors

 

T. maritima Browser

TOPSAN > Proteins > JCSG > 1o6a

1o6a

    Page last modified 03:45, 25 Aug 2011 by Admin
    Email link
    Page Notifications Off
    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of the C-terminal fragment of the putative flagellar motor switch protein FliN (TM0680a) from Thermotoga maritima at 1.85 A resolution. To be published
    Site JCSG
    PDB Id 1o6a Target Id 356088
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1355,TM0680 Molecular Weight 17302.83 Da.
    Residues 162 Isoelectric Point 4.16
    Sequence mteneflsqeeidkllsdsdtggvltpeekdmigeigniamgsaattlsmilgrdihitvptvreekmk nvksdfsgeqvvvsveytegleglnvlvldkklvaviadlmmggsgeveteeldeiklsavgeamnqmm gsaatslsellgitinisppkvei
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.85 Rfree 0.21199
    Matthews' coefficent 2.50 Rfactor 0.17102
    Waters 150 Solvent Content 50.33

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The gene TM0680 from Thermotoga maritima encodes the C-terminal domain of the flagellar motor switch protein FliY (PF07859).  The complete FliY protein possesses phosphatase activity [Ref].  Structurally, it can be related to CheC protein from the same organism 1XKR SCOP103038 PF04509.  The protein belongs to a group of factors controlling bacterial chemotaxis.

    Ligand Summary



    References

    Reviews References Images Files Tags

    Reviews

    References

     

    1. Park SY, Chao X, Gonzalez-Bonet G, Beel BD, Bilwes AM, and Crane BR Structure and function of an unusual family of protein phosphatases: the bacterial chemotaxis proteins CheC and CheX. Mol Cell. 2004 Nov 19; 16(4):563-74 PubMed HubMed doi:10.1016/j.molcel.2004.10.018 pmid:15546616.

       


      Discuss this publication
    Add tag
    Tag page
    What links here
    Attach file or image

    Files (0)

     
    Attach file or image

    Images (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch